Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025538 (Sumf2)
Chromosomal location
Chr 5: 130322872 - 130339928 (+)
Description
sulfatase modifying factor 2 Gene [Source:MGI Symbol;Acc:MGI:1915152]
RefSeq_dna
NM_026445 
RefSeq_peptide
NP_080721.1 
UniGene
Mm.103546 
MGI
MGI:1915152 
Uniprot/SWISSPROT
Q8BPG6 
Uniprot/SPTREMBL
Q0VDW5 Q3TM08 Q3TZL1 
Human Ortholog
ENSG00000129103 (SUMF2)
Omim not available
UniTrap UNI11316
Vector Insertion
Chr 5: 130322963 - 130325776
Public Clones D107B06 (ggtc) G066C11 (ggtc) D107A05 (ggtc) IST11691B8 (tigm) IST10131C7 (tigm)
Private Clones OST450359 (lexicon) OST378099 (lexicon) OST309010 (lexicon) OST297947 (lexicon)
OST246264 (lexicon) OST239852 (lexicon) OST232282 (lexicon) OST182698 (lexicon)
OST146532 (lexicon) OST145358 (lexicon) OST145355 (lexicon) OST144777 (lexicon)
OST144652 (lexicon) OST144083 (lexicon) OST144012 (lexicon) OST142784 (lexicon)
OST102687 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24379
Vector Insertion
Chr 5: 130325934 - 130328749
Public Clones IST14811D11 (tigm)
Private Clones OST222986 (lexicon) OST222021 (lexicon) OST180370 (lexicon) OST178844 (lexicon)
OST68064 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17648
Vector Insertion
Chr 5: 130334172 - 130335712
Public Clones not available
Private Clones OST439009 (lexicon)
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000060259
Sequence
ATGCGCTCTGAGTTCTGGTTCCCCAGCATGGGTTCCTTGCTCCCTCCGGTGTTGCTGCTGTGGCTCCTGTCCTGCCCCAGGCTTCAGCTAG - UNI113

16 - GACATGCCCAGGATCCTGCCATGGTGCATCTGCCAGGTGGCCGGTTTCTGATGGGGACAGACGCTCCAGATGGCAGAGACGGTGAAGGGCCTGCC

CGGGAAGTGACAGTAAAACCCTTTGCCATCGACATATTTCCAGTCACCAATAAAGACTTCAG - UNI24379 - GGAGTTTGTCAGGGAGAAGAAGTA

CCAGACTGAAGCCGAGGCATTCGGGTGGAGCTTCGTCTTTGAGGATTTTGTCTCCCCTGAGCTCAGAAAGCAAGAAAATCTGATGCCG GCTGTTCACTG

GTGGCAGCCAGTGCCAAAGGCATTTTGGAGGCAG CCTGCAGGTCCCGGCTCTGGCATCCGAGAGAAACTGGAGCTTCCCGTGGTACACGTGAGCTGGAA

CGACGCTGGTGCTTACTGCGCATGGCGGGGGAGACGCTTGCCCACAGAAGAGGAGTGGGAGTTTGCAGCCCGAGGGGGCTTGAAGG GTCAGGTTTATCC

ATGGGGGAACCGGTTCCAGCCAAACCGCACCAACTTATGGCAG - UNI17648 - GGAAAGTTCCCCAAAGGTGACAAAGCTGAAGATGGTTTTCATG

GACTGTCACCAGTGAACGCTTTCCCCCCACAGAACAACTACG GACTGTATGACCTCATGGGCAATGTGTGGGAGTGGACAGCGTCCACATACCAACCTG

CTGGCCAGGACATGCGTGTCCTCCGGGGGGCATCATGGATCGACACCGCAGACGGCTCTGCTAATCACAGGGCTCGGGTCACCACCAG GATGGGAAACA

CTCCAGACTCAGCCTCAGACAACCTGGGCTTCCGCTGCGCCTCCAGTGCAGGCCGACCGAAGGAGGACCTGTGAGCAGCCAGACCGAGATCTCCGAAGCA

CCCTCTCAGCACTGTACCTCCGTGACCATGTTCCAGAGGCAGCTGGCTACCAAGCTCATGCGTCTGAGGGTGGCCTTTTGAGCCCCTCCCCTCTGACAGA

CACAAAGAACACTCGGACTGCAAGAAGGGACTGCAGTAGCCTGGAAGATGAGGACCTGGATGACCAAGGCTGGGAGCTGGGCTGTCTCTTAAGTGCAGTA

TTAAGGACAAAGGAACCAAACCCTCCAGTGTCCAAAAGATGACATTTTTTAAACTCTCTCCCTTTTTGCTTTCTCCCTGGCTGGTTCAGCTTTCACTTCT

GGGAAATTCTGCAGAAGGAAAATGCTTCCTTTGTGAGGTGTGCCAAAGCCTTGCTGCCAGAACCTAGCCTCGCTGGCCTCTGAAACGAGATACTCAATAT

GTGGCAAGGCTGGTCTCGAACTCTCGATCCTCCTACCTCAGCTTCCTGGGTCCTGCTGGGATTACACACCACGCCCACTATTTAAAAGCCCCAGTAAAGC

AAATGATTTATGAAGTGAAGATGTGCATTGTGGGAGAACCAAAGTCAGTGCCCCTCTAGGAAGACAAATGCCAGAACCTTCTCTGAGAGTTAGCTAATCA

TGTAGGGCCTTCTGTGTATCCTGCAGACATGTCCCTGAAGAAGAACTGGATCTTATGAGGTCAATAAATCCTTTTTTTTTTTTAAGATTTATTTATTTAT

TATATGTAAGTACACTGTAGCTGTCTTCAGACACACCAGAAGAGGGCATCAGATCTCGTTACGGATGGTTGTGAGCCACCATGTGGTTGCTGGGACTTGA

ACACTGGACCTTTGGAAGAGCAGTCGGGTACTCTTACCCACTGAGCCATCACACCAGCCCGAGGTCAATAAATTCTTATGTATATCAGGAAGCACAATAT

AATTGTTGTTTGAGATAGGGTTTCATGTAGCCCAGGCTAGCCTCAAGCTCCTTGTGTAGCCACAAATGACCTTGAACTCCTGCTTTCACTTCCTCAAATA

TCCATAACTTTAGCTAGACAGTTATGAGCGCCTGTTCTTGCTGAGGAGGGGTTCAATTCCTACCACCCACAAGGTGGGCTCAGCTATCTATACAACTCCA

GTTTCAGGGTTTCTGATGCCTTCTTGTGACCTCTACAGGTACTGCATGCATGTGGGTTACATAAAATGCATGCAGCTAAAACATACATAAAATGCATAAA

TCTTAAAAAAAAAAACAAGAAAACTATAGACATCAACAAAGGTGCACAGTAGAGAAGCCAGAAGGCTTATAGCTCCCAGAATACATGTGCTCTATGCCCT

TCC
Translation
MRSEFWFPSMGSLLPPVLLLWLLSCPRLQLG - UNI11316 - GHAQDPAMVHLPGGRFLMGTDAPDGRDGEGPAREVTVKPFAIDIFPVTNKDFR -

 UNI24379 - REFVREKKYQTEAEAFGWSFVFEDFVSPELRKQENLMP AVHWWQPVPKAFWRQ PAGPGSGIREKLELPVVHVSWNDAGAYCAWRGR

RLPTEEEWEFAARGGLKG GQVYPWGNRFQPNRTNLWQ - UNI17648 - GKFPKGDKAEDGFHGLSPVNAFPPQNNYG GLYDLMGNVWEWTASTYQ

PAGQDMRVLRGASWIDTADGSANHRARVTTR RMGNTPDSASDNLGFRCASSAGRPKEDL

For any suggestions or comments, please send an email to unitrap@crg.es