Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025571 (Tnrc6c)
Chromosomal location
Chr 11: 117515603 - 117624753 (+)
Description
trinucleotide repeat containing 6C Gene [Source:MGI (curated);Acc:Tnrc6c-001]
RefSeq_dna
NM_198022 
RefSeq_peptide
NP_932139.2 
UniGene
Mm.40272 Mm.401036 
MGI
MGI:2443265 
Uniprot/SWISSPROT
Q3UHC0 
Uniprot/SPTREMBL
B1ATC3 
Human Ortholog
ENSG00000078687 (TNRC6C)
Omim not available
UniTrap UNI31092
Vector Insertion
Chr 11: 117516646 - 117562038
Public Clones (sanger) 5SD069D03 (ggtc) 3SD176D10 (ggtc) 3SD034G02 (ggtc) 3SD172B02 (ggtc)
5SE044B05 (ggtc) 3SD069D03 (ggtc) 3SP134G03 (ggtc) 5SD032H11 (ggtc)
3SE289D01 (ggtc) 5SD183D09 (ggtc) 5SD034G02 (ggtc) 5SD172B02 (ggtc)
3SD032H11 (ggtc) IST14653D6 (tigm) IST14451G2 (tigm) IST14766F11 (tigm)
IST14901E12 (tigm) IST14397E10 (tigm) IST14727G9 (tigm) IST14790E12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25881
Vector Insertion
Chr 11: 117562139 - 117563692
Public Clones not available
Private Clones OST155002 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16511
Vector Insertion
Chr 11: 117563715 - 117575439
Public Clones E089H05 (ggtc) IST14962E1 (tigm) IST14176C1 (tigm)
Private Clones OST459475 (lexicon) OST363629 (lexicon) OST184561 (lexicon) OST45033 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6583
Vector Insertion
Chr 11: 117575767 - 117582263
Public Clones YHB232 (baygenomics)
Private Clones OST187638 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000026658
Sequence
GAAAACGCTGCGCAAACCCGGGATACGGCGGGGCGCAGAACCGGAGAACGGAGGCGGCTACGCAGAACTGAATCTGCGGCCCTTTGGTGCGCAAGCTAAC

GCGGAGTCACAGTGCCCAAAAGCGTGAAGGCAAGCGGCCACGGGAGAATTCCGCACGGCTCTCCGCATTGACCGGGAAGGAGCGTCAGCTCCGAGGAAAG

GCGCGCGTCCGAGGCGCGTGAAGAACGCGCAGCTCGCACCCCCGCGCGCTCCACGCGCGGTCTGGACGACCACAGCGCGGGCGGGTATTAGGGGAGAAGG

AGGAGGCGTGGTCTTTTCGTGACGAACCAATGGGATCGGGAGCACTGCCTGGAGGCGGAGCTCAGGATCAGGGCGCTGATTGGCCATTCCGCCCTCCG -

 UNI31092 - GGTAAAAGAACAGGAAACACAAGAAGAGGAACGTTTGATGGAAGAAAAGAAAAAGAAAAAGCAGGAAGACAAGAAAAAGAAGGAAGGT

GCTCAGAAAAAG - UNI25881 - GCTGCTGATCAAAAAACCAAAG - UNI16511 - TGCCAGAACTTACTAAGACCTGTTCAAGCCAGCCCCAA

CCTGCCGGTACCAGTCCCAGTACTTCCACCAGCACTATTTCTAGCGGCAGCAATGGCAAACGTGCATCTGCCTGTGGCCAGCAGCCAGCTGCATCCCGTT

ACCTGCCTCGGGAGGTGCCTCCACGCTTTCGCCAGCAAGAACAGAAGCAGCTGTTAAAGAGAGGCCAGCCATTGCCCACAGGGGGTCTGACCAGTTTGAA

CTCAGCACAGGCTGCTGGACCTGCAGGGGCCAGCCCTCCTCCCCTCCCTGGAGCTGGGGCACAGCAACATCCCAGCAAGCTCCAACAAG - UNI6583 

- ATCTTGGTCACAGTGGATTGGTAGATCATTATGAAAATTCCCACTGGGGACAGCATCCCTCTTACAGAAGTGAAGCCAACTGCAGCTGGGATAAAGTG

ATAATAGACAGGACTGAGCCGGAGGTGTGGCCGTCCATCCCAGTAACTGAGACGGAATCTGCCTCAGAATGTCCTACCGACACTGACTCTGCCTCCAACT

GTGGCTCAGAGAACAGTAGCATGGCTACAGGGAGTGCCCAGAGCAGCTTCCCGAGCCACCTGAAGAAGACAAACGGCAGTCATGGCACCAATGGCGCACT

CGTCCAAAGCCCTTCTAACCAGAGTGCCCTTGGGGCAGGAGGAACCAATGGGAACGGGGGCGTGGCCAGAGTGTGGGGTGTAGCCACAAGCTCCAGCTCT

GGCCTGGCTCACTGCTCTGTTGGTGGTGGAGATGGGAAAATGGACAACATGATCGGAGATGGGAGAAGTCAGAATTGTTGGGGTGCTTCTAACTCCAATG

CGGGCATTAATCTCAACCTTAATCCAAATGCCAACCCAGCTGCCTGGCCTGTACTCGGGCATGAAGGAACTGTGGCAACAGGCAACCCTTCCAGTATTTG

CAGTCCAGTCAGTGCCATAGGTCAGAATATGGGCAGCCAGAATGGGAACCCAGTGGGCGCCCTAGGTGCCTGGGGAAACTTGCTGCCCCAAGAGAGCGCA

GAACCACAGACATCCACTTCTCAGAATGTGTCTTTCAGCGTACAACCTCAGAACCTTAACACTGATGGACCAAATAACACTAACCCCATGAACTCTTCAC

CAAACCCTATCAATGCAATGCAGACAAACGGACTGCCAAACTGGGGCATGGCTGTTGGTATGGGGGCCATCATCCCACCCCACCTGCAAGGCCTTCCTGG

TGCTAACGGATCATCAGTCTCTCAAGGCAGTGGGAGTGGTGGGGAAGGAATGGGCAGTTCTGTGTGGGGACTGTCCCCTGGTAACCCTGCCACAGGAAGT

ACCAATTGTGGGTTCAGTCAAGGGAATGGAGACACTGTGAACTCAGCATTAAGTGCTAAGCAGAACGGATCCAGCAGTGCTGTGCAGAAGGAAGGGAATG

GAGGGAACGCCTGGGACTCAGGGCCTCCTGCAGGGCCTGGCATCCTTGCCTGGGGAAGGGGCAGTGGCACCAATGGCATTGGTAATATCCATTCAGGAGC

TTGGGGCCATCCCAGCCGAAGTTCTTCTAATGGTGTGAATGGGGAGTGGGGGAAGCCCCCAAACCAGCATTCCAGTAGTGACATCAGTGGGAAAGGATCA

ACAGGGTGGGACAGTGCCAGTGCTGCCAGCCAGACCCCTGCCCTGCAGCCTGGCAGTGAACACATGAACTCGTGGGCCAAAGCCACATCTTCTGGAACTA

CAGCAAGTGAAGGAAGCAGTGATGGGTCCGGCAATCACAATGAAGGAAGCACTGGGAGGGAAGGGACAGGAGAGGGCCGGAGGCGAGACAAAGGGGTTCT

AGACCAAGGGCACATCCAGTTGCCAAGGAATGACCTTGACCCAAGAGTTCTGTCTAACAGTGGTTGGGGACAGACTCCCGTAAAGCAAAACACTGCCTGG

GAATTTGAAGAGTCCCCTAGGTCTGAAAGGAAAAATGACAATGGGACAGAGGCCTGGGGTAGTATAGCTACTCAGCCTTCAAACTCAGGGGGGAAGACTG

ATGGGTCCATCATGAACAGTACAAATACCTCTTCAGTATCGGGGTGGGTCAGCTCACCACCTGCCGCCGTGCCAGCAAACACAAGCTGGGGAGACAGCAA

CAACAAAGCGCCAAGTGGCCCAGGAGTTTGGGGGGACTCAATAAGCTCTACTGCTGTTAACAATGCTGCTGCCACCAAGAGTGGCCATGCTTGGAGTGGG

ACTGTAAACCAAGAGGACAAATCACCCACCTGGGGTGAGCCTCAGAAGCCCAAATCCCAAAACTGGGGAGATGGACAAAGAGCAAACCCAGCCTGGAGCA

CAGGGGCAGGAGACTGGGCAGATTCATCATCTGTCCTTGGACATCTAGGGGATGGAAAGAAAAATGGATCTGGATGGGATGCTGATGGTAATAGGTCAGG

GTCTGGTTGGAATGATGCCACGAGATGTGGGACCAGTGGCTGGGGCAGTGGCACAAATGCTAAGGTGAATCCAGGTACAAACTGGGGGGAGTCTCTCAAG

CCTGGTCCCCAGCAGAACTGGGCTCATAAGCCCCAAGACAACAATGTGAGTAACTGGGGAGGAGCTGCTTCTGTTAAGCAGACAGGGACAGGGTGGATTG

GGGGGCCACTGCCAGTCAAGCAGAAGGACAGCAGTGAGGCGACTGGCTGGGAGGAGCCTTCCCCACCCTCCATCCGACGCAAAATGGAAATTGATGATGG

TACCTCAGCTTGGGGGGACCCAAGCACCTACAACAATAAAACTGTAAACATGTGGGACAGAAACAATCCAGTCATCCAGAGCAGTACCACAGCCCCTGCC

ACCCCCACGACCCCCACCTCGAGCAGCACCACACACCGGGCCGAGACGCCGCCTTCACACCAGGCTGGCACTCAGCTGAATCGGTCACCACTGCTCGGGC

CAG TTTCATCCGGCTGGGGAGAGATGCCCAGTGTTCACTCCAAGGCCGAGAACTCCTGGGGAGAGCCATCTTCCCCTTGTACCCTGGTGGACAATGGCA

CAGCAGCGTGGGGGAAGCCTCCCAGCAGTGGCAGTGGGTGGGATCATCCTGCTGAGCCGGTGGTGCCATTTGGAAGAGCCAGCGCTCCTGCTGCCGCCCC

AGCCCTGTGCAAACCAG CTTCCAAATCTATGCAAGAAGGCTGGGGCAGCGGTGCGGATGAAATGAACCTGGGCACCAGCCAGTGGGAGGATGAGGACGG

GGACATGTGGAACAACGCTGCCTCCCAAGAAAGCAGCTCATCCTGCAGCTCCTGGGGCAACACCTCAAAAAAAGGACTTCAGAAG GGCATGAAGACTCC

TGGCAAGCAGGATGAGGCCTGGATCATGAGCCGGCTGATCAAACAACTCACAGACATGGGCTTCCCG AGAGAGCCAGCCGAAGAGGCCTTGAAAAGCAA

CAGTATGAACCTTGACCAGGCCATGA GTGCTCTGCTGGAAAAGAAGGTGGACATGGACAAACGTGGACTGGGAATGACCGACTACAATGGAATGGTCAC

CAAACCCCTCGGCTGCCGCCCACCAATCTCCAAAGAGTCTTCCATGGACCGCCCCACCTTCCTTGACAAG CTCACCCTTTCTTTCTCCAATCAGGATGG

CGGCCTCGTGGAAGAGCCCACGACTTCACCGTTTTTGCCTTCCCCAAGCCTGAAGCTCCCCCTTTCCAACAGTGCACTCCCCAGTCAGGCCCTGGGTGGG

GTTGCCTCAGGGCTGGGCATGCAAAACTTGAACTCTTCTAGACAG ATCCCGAGTGGCAATCTGGGTGTGTTTGGCAATAGCGGAGCAGCACAAGCCAGG

ACCATGCAGCAGCCGCCAGTGCAGCCTCTTAATTCCTCCCAGCCCAGCCTCCGCGCTCAAGTGCCTCAGTTTCTATCCCCTCAG GTTCAAGCACAGCTT

TTGCAGTTTGCAGCAAAAAACATTGGTCTCAGCCCTGCACTATTAACCTCGCCAATTAACCCTCAGCATATGACGATGTTGAACCAGCTCTATCAGCTGC

AGCTG GCATACCAACGTTTACAAATCCAGCAGCAGATGTTACAGGCCCAGCGGAATGTTTCCGGACCCATGAGGCAACAGGAGCAGCAA GTTGCGCGC

ACAATCACTAATCTGCAGCAGCAGATCCAGCAGCACCAGCGCCAGCTGGCCCAGGCCCTGCTTGTAAAGCAGCCACCACCTCCGCCACCCCCGCCGCACC

TGTCTCTGCACCCCTCTGCAGGCAAATCGGGCATGGAGAGCTTCCCCCCTCCCCCCCAGGCTCCCGGCCTTCCCGACCTGCAGACCAAAGAGCAGCAGTC

TTCACCCAACACCTTTGCTCCTTATCCTCTTG CTGGATTGAACCCGAACATGAATGTCAACAGCATAGACATGAGCAGTGGCTTGTCTGTGAAGGACCC

GTCGCAGTCCCAGTCACGCCTGCCTCAGTGGACACATCCCAACTCCATGGGTAACTTGTCTAGTGCTGCTTCTCCCCTGGACCAGAATCCTAGCAAGCAT

G GTGCTATCCCTGGAGGTCTAAGCATCGGGCCTCCAGGTAAGTCCTCCATTGATGACTCTTACGGCCGGTACGATTTAATTCAGAACAGTGAGTCACCA

GCCAGTCCTCCCGTAGCTGTTCCCCATAGCTGGTCACGTGCCAAATCTGACAGTGATAAAATCTCAAATGGCTCCAGCATCAGCTGGCCCCCAG AATTC

CACCCTGGAGTTCCATGGAAAGGACTTCAGAACATTGACCCTGAGAATGACCCTGATGTCACGCCTGGCAGTGTCCCTACAGGACCTACCATCAACACCA

CCATCCAGGATGTCAACCGCTACCTCCTCAAGAGTGGAG GTAAGCTGTCTGATATTAAATCAACATGGTCCTCAGGCCCAGCCTCTCACACGCAAGCCT

CTCTGTCTCATGAGCTGTGGAAGGTACCCAGAAACACTACTGCACCCACCAGGCCGCCTCCAGGCTTAGCCAATCCCAAGCCTTCCTCCACCTGGGGCAC

CAGCCCCCTCGGCTGGACCAGCTCCTACTCCTCGG GTTCTGCATGGAGCACTGACACCTCAGGAAGAACAAGCAGCTGGCTCGTTCTGCGCAATCTCAC

ACCCCAG ATCGATGGTTCTACACTTCGGACGCTGTGTCTGCAGCATGGACCTCTCATCACATTCCACCTGAACCTAACCCAGGGCAACGCTGTAGTCCG

CTACAGTTCTAAGGAAGAAGCCGCCAAGGCCCAGAAGTCTCTGCACAT GTGTGTACTGGGAAACACCACCATCTTGGCTGAGTTTGCCGGGGAAGAAGA

AGTGAACCGGTTCCTGGCCCAAGGCCAAGCCCTCCCACCCACCTCCAGCTGGCAGTCCAGCAGCGGGGGCAGCCAGCCCAGACTGGGCACCTCGGGCAGC

ACCCATGGCCTAGTGCGCAGCGACACTGCCCACTGGAACACCCCATGCCTGAGTGGCAAAGGCAGCAGTGAGCTGCTGTGGGGTGGGGTCCCCCAGTACT

CCAGCAGCCTGTGGGGCCCGCCCAGTGCTGAGGACGCCAGAGTGATCGGCAGCCCCACGCCTCTCAACACTCTGCTGCCTGGGGACCTGCTCAGCGGCGA

GTCCATCTAGGGGCCACGGTCACTGGGGGAAGAGAGCTGACCATGCCAGGGCCGGCTCCGAAGCTCCAGCTGACGGACAAGCTGCCCCTTGGAGTACCTC

TGTCCAGTCTGAAGATGAACCTTGGCCTCGGCCCCTGTGAACTGTTGAAGACAGTGCGGGCTGAGGTTGGTCAGTGTCATGTGCTAAGGACAGGACGTCT

CTCATAGCTTTTTATTTCATGTCGTCTTAGGTTTGTACAGTGCGCTGCCATTTTGAGTTTTAAGTATAAAAGCTGCTTAGAATAGTTCTATCATGAAGGG

CACTTTTCAGATTGTGGGCTGGAAAGGGTTATTTTATGGTGGGGTGGGGGGAGACTTGAAGCCTATTTAAAGTGAGCCTGTGACGATTATGCACATTACA

GAGGCGGTAGGCGGGACAGGCGGCTGGGCTGCGTTGTGCGGGCACAGAGCTGAGGCGTGTGGCCAGTGCTCTGTCCCCCCGATCGCCTGCGCACATTACC

CTCGTTTCGTTACCTTTTCATGTCATTTTTTTTTATCCCAAAAAAATATTTTTTAAAAGTTAAAAAAAAAAAGACATATCAAACATGCAAATACTTGAAC

CCAGCAGGCCAATACCGAAATGTGAACACTTCCACGTTGACATCCGTGCACAGAAACAGGCTCTAGGAAATGTCTACGTTCATAGCCTACATGTGCGTGT

ATGCGTGAGTGCGTGTGCTTGTGTGCTTGTGTGGTGCGGTGTGCAGAAGAGTGTGTGTGAGTGTGTTCTTGCACAGGCAGGGCTTCCTGTGCGTGCGTGC

GCACTTGAGTGTGTGAGGGACTTAACTGTGGGTTTCCCTTCTAGTCAGTATATGCTTTTGGTTTTGGTTTTTTTGGGGGTTTTTGTTTTTGTTTGTTTTG

TTTTTTGTTTTTGGCATTGGTCAAATGTTCTCATTGTTGTTATTTGCTTCTAACTTTGCACTGAGGTGTCTCTGCCCTTCCTTTAGCTAATCCTAAACAG

TAAAGAGAATTCTCGGGACAGGGCTGGTGACAATTCATGTGTAAATGTTTACTCAAGGACTCTGTTGTTGCATTTAAAGTCGCAGTGTATATCTCTGGAG

AAATGATGTGTCTGTCTACTTCAGCAGCTTGTCATTGTGGACTCATGCAGAAGATTATTACCAGAGTATTGCACCACTTCCCATCTGCAATATAAAGTTA

AAGAGAAAAACAAACTCTTGTTGAACTGTGGCCATAGATACTTGTAGAGACTGGTGCCGCGCACGAGGCGCGGGCGGGCGGGCGGCCGGCCGAGCACTTG

GACGTGGTGGTGACTGCTTTTGGAGGAGCTGTGTTTGGGCTCCCACCTGTTTACAGACTTTTTTTTTTTTTTTTTCCTCCTTCAGACTTTAAAATAAAAT

TTTAAAAAAATTTTAAAAATGTTAAAAGGAATAAAAAAAAAAGACTTCCATCATTTAAAACAAACAAGCAAACAAACAGCAACCTATTTTCAGATACAGA

TGTGTTGCTCCAGAGCTCTGGGATGGGACATGCTGTTCCCCTCCAGCCGTCGCGCGTGCGCGGACTCTGTGGACTGTCTTCACCCCTCCTCAAGGTGACA

GGGCCTCGTGGTCTCTGTCTTGCACACGCCAGCTCGCTCTCAGGAACGCCAGGGCTCCCGAGGGCGGTGCCACACCACTTCATGTATTTTTAAACCCAAC

TCCTAGCACTGAAGATGTTATTTAAAAAAAAAAAAAAAAAAAAAGAGAGAGAAAAAAAAAGAAAGAAAAGAAAAAAACACACACACACACACAAAGAAGA

AAAATACCTAATCTCTAATGTGTAGCAGTTACATATTTACCAAATAATGGACTCAAAAGAAATAGATGTTTGAAGAGTGCTTTATATATTAAAAATTGCT

TTATGTTTTAAAGATGATCAATGTTTTGATTGTTTTACAAGGAAGAAAGACAATGAAATCACACACCCTCAAGTATGTTTTAGAAAAGTATATGAACATT

GTACTCCCTGCCTACGTGGTCGGGAAACTTGTGCATTACATTTTTTAATTAGCTTTTTAATGGTTTTATCAAAACAGAAAGCAAGCAAGCAAGTCCTGCA

CGGTTGCAGCAACGCAGTGCTTTCTTAGAGGATCAGGAACTATGCACAACTGGGTTCAAAACTTGTTCGAGTTTTGTTATGTATCCCACGGAATGGCCCT

CCTCAGAGTGACTGCATCTCATCGCCATTACGTGCGTCCTAGATATTTGATGTATGTATATCCAAGTATGTATATCAAATACGTGCGTGTGCGCGCTCCC

AGACGCACAGCTTGCCATGCTGCCATTTAGCACTGAGTTGTAGAAAAACTCATGTTTTAAAACTGGGGATGGAAGGAAAAGATGTTCCCAGTTTTTGTGG

GCTTTCCCCTCTTTTTCCTTTTTGATCCTTTTGAATTTTAAATGTCTCTGACTCTAAGATTAAAAGAAAAAGTTTGTGGCGCTTAATGCCCTCCTCTTGG

AATGTGATGGTTGGACGCACACCGGAGGTTGCTTTCGAAAAATAACAGCGCTTTGTTGAGTCTTAATAAACTGCAGTTTTTCTTGGCTATTGATGT
Translation
 - UNI31092 - MEEKKKKKQEDKKKKEGAQKK - UNI25881 - AADQKTKV - UNI16511 - VPELTKTCSSQPQPAGTSPSTSTSTISSG

SNGKRASACGQQPAASRYLPREVPPRFRQQEQKQLLKRGQPLPTGGLTSLNSAQAAGPAGASPPPLPGAGAQQHPSKLQQD - UNI6583 - DLGHSG

LVDHYENSHWGQHPSYRSEANCSWDKVIIDRTEPEVWPSIPVTETESASECPTDTDSASNCGSENSSMATGSAQSSFPSHLKKTNGSHGTNGALVQSPSN

QSALGAGGTNGNGGVARVWGVATSSSSGLAHCSVGGGDGKMDNMIGDGRSQNCWGASNSNAGINLNLNPNANPAAWPVLGHEGTVATGNPSSICSPVSAI

GQNMGSQNGNPVGALGAWGNLLPQESAEPQTSTSQNVSFSVQPQNLNTDGPNNTNPMNSSPNPINAMQTNGLPNWGMAVGMGAIIPPHLQGLPGANGSSV

SQGSGSGGEGMGSSVWGLSPGNPATGSTNCGFSQGNGDTVNSALSAKQNGSSSAVQKEGNGGNAWDSGPPAGPGILAWGRGSGTNGIGNIHSGAWGHPSR

SSSNGVNGEWGKPPNQHSSSDISGKGSTGWDSASAASQTPALQPGSEHMNSWAKATSSGTTASEGSSDGSGNHNEGSTGREGTGEGRRRDKGVLDQGHIQ

LPRNDLDPRVLSNSGWGQTPVKQNTAWEFEESPRSERKNDNGTEAWGSIATQPSNSGGKTDGSIMNSTNTSSVSGWVSSPPAAVPANTSWGDSNNKAPSG

PGVWGDSISSTAVNNAAATKSGHAWSGTVNQEDKSPTWGEPQKPKSQNWGDGQRANPAWSTGAGDWADSSSVLGHLGDGKKNGSGWDADGNRSGSGWNDA

TRCGTSGWGSGTNAKVNPGTNWGESLKPGPQQNWAHKPQDNNVSNWGGAASVKQTGTGWIGGPLPVKQKDSSEATGWEEPSPPSIRRKMEIDDGTSAWGD

PSTYNNKTVNMWDRNNPVIQSSTTAPATPTTPTSSSTTHRAETPPSHQAGTQLNRSPLLGPV VSSGWGEMPSVHSKAENSWGEPSSPCTLVDNGTAAWG

KPPSSGSGWDHPAEPVVPFGRASAPAAAPALCKPA ASKSMQEGWGSGADEMNLGTSQWEDEDGDMWNNAASQESSSSCSSWGNTSKKGLQK GMKTPGK

QDEAWIMSRLIKQLTDMGFP REPAEEALKSNSMNLDQAMS SALLEKKVDMDKRGLGMTDYNGMVTKPLGCRPPISKESSMDRPTFLDK LTLSFSNQD

GGLVEEPTTSPFLPSPSLKLPLSNSALPSQALGGVASGLGMQNLNSSRQ IPSGNLGVFGNSGAAQARTMQQPPVQPLNSSQPSLRAQVPQFLSPQ VQA

QLLQFAAKNIGLSPALLTSPINPQHMTMLNQLYQLQL AYQRLQIQQQMLQAQRNVSGPMRQQEQQ VARTITNLQQQIQQHQRQLAQALLVKQPPPPPP

PPHLSLHPSAGKSGMESFPPPPQAPGLPDLQTKEQQSSPNTFAPYPLA AGLNPNMNVNSIDMSSGLSVKDPSQSQSRLPQWTHPNSMGNLSSAASPLDQ

NPSKHG GAIPGGLSIGPPGKSSIDDSYGRYDLIQNSESPASPPVAVPHSWSRAKSDSDKISNGSSISWPPE EFHPGVPWKGLQNIDPENDPDVTPGSV

PTGPTINTTIQDVNRYLLKSGG GKLSDIKSTWSSGPASHTQASLSHELWKVPRNTTAPTRPPPGLANPKPSSTWGTSPLGWTSSYSSG GSAWSTDTSG

RTSSWLVLRNLTPQ IDGSTLRTLCLQHGPLITFHLNLTQGNAVVRYSSKEEAAKAQKSLHM MCVLGNTTILAEFAGEEEVNRFLAQGQALPPTSSWQS

SSGGSQPRLGTSGSTHGLVRSDTAHWNTPCLSGKGSSELLWGGVPQYSSSLWGPPSAEDARVIGSPTPLNTLLPGDLLSGESI
Transcript ENSMUST00000106344
Sequence
AGTTAGAGCAACAAGATGGCCGCGGTGGCAGCTCCGCACCTCAGCGCGACGGCCCCGGGAGCCGCAGCCGCCGTCGCCGTCCGCGTCGCCGTGCAGCCCT

GAGAGCCGCCGGGTCACCCCGGCCGCCCCCGTGACAGGCGGTCCTCGCGCCGTCGCGCTCCCGCCGCCGCCGCCGCGGGCCCGCTCGAGCCGGAGCCTGA

GGCGGAGGGAGCGGAGCGGCCCCGCGCCCAGCCGCCCATCGCCGTCCCCGCCTCAGACCCGGGCTGCGTCCGAGCCGCGGCCCGCCGAGACTTAGGAGCA

GGGCGCGTCGCGGCGTCGCGGGCACTGGACCTGGACCTGCCGGGACGTGCCGCCGCCCACCCGCCGCCCGCGCCCGGACTCGATCCTGCGGCGCCGGCAC

TGAGCGGGCCCCCGCCGCCGGAGCGCCCCCGAGGGCCCCGGGCGGCCGAGAGCGACCTCTCCACCGCCAGGCCCGCGCCGCCGGAGCCCCGCGGAGCCGC

CGCCGGGGACGGAGCCCAG - UNI31092 - GGTAAAAGAACAGGAAACACAAGAAGAGGAACGTTTGATGGAAGAAAAGAAAAAGAAAAAGCAGGAA

GACAAGAAAAAGAAGGAAGGTGCTCAGAAAAAG - UNI25881 - GCTGCTGATCAAAAAACCAAAG - UNI16511 - TGCCAGAACTTACTAAG

ACCTGTTCAAGCCAGCCCCAACCTGCCGGTACCAGTCCCAGTACTTCCACCAGCACTATTTCTAGCGGCAGCAATGGCAAACGTGCATCTGCCTGTGGCC

AGCAGCCAGCTGCATCCCGTTACCTGCCTCGGGAGGTGCCTCCACGCTTTCGCCAGCAAGAACAGAAGCAGCTGTTAAAGAGAGGCCAGCCATTGCCCAC

AGGGGGTCTGACCAGTTTGAACTCAGCACAGGCTGCTGGACCTGCAGGGGCCAGCCCTCCTCCCCTCCCTGGAGCTGGGGCACAGCAACATCCCAGCAAG

CTCCAACAAG - UNI6583 - ATCTTGGTCACAGTGGATTGGTAGATCATTATGAAAATTCCCACTGGGGACAGCATCCCTCTTACAGAAGTGAAGCC

AACTGCAGCTGGGATAAAGTGATAATAGACAGGACTGAGCCGGAGGTGTGGCCGTCCATCCCAGTAACTGAGACGGAATCTGCCTCAGAATGTCCTACCG

ACACTGACTCTGCCTCCAACTGTGGCTCAGAGAACAGTAGCATGGCTACAGGGAGTGCCCAGAGCAGCTTCCCGAGCCACCTGAAGAAGACAAACGGCAG

TCATGGCACCAATGGCGCACTCGTCCAAAGCCCTTCTAACCAGAGTGCCCTTGGGGCAGGAGGAACCAATGGGAACGGGGGCGTGGCCAGAGTGTGGGGT

GTAGCCACAAGCTCCAGCTCTGGCCTGGCTCACTGCTCTGTTGGTGGTGGAGATGGGAAAATGGACAACATGATCGGAGATGGGAGAAGTCAGAATTGTT

GGGGTGCTTCTAACTCCAATGCGGGCATTAATCTCAACCTTAATCCAAATGCCAACCCAGCTGCCTGGCCTGTACTCGGGCATGAAGGAACTGTGGCAAC

AGGCAACCCTTCCAGTATTTGCAGTCCAGTCAGTGCCATAGGTCAGAATATGGGCAGCCAGAATGGGAACCCAGTGGGCGCCCTAGGTGCCTGGGGAAAC

TTGCTGCCCCAAGAGAGCGCAGAACCACAGACATCCACTTCTCAGAATGTGTCTTTCAGCGTACAACCTCAGAACCTTAACACTGATGGACCAAATAACA

CTAACCCCATGAACTCTTCACCAAACCCTATCAATGCAATGCAGACAAACGGACTGCCAAACTGGGGCATGGCTGTTGGTATGGGGGCCATCATCCCACC

CCACCTGCAAGGCCTTCCTGGTGCTAACGGATCATCAGTCTCTCAAGGCAGTGGGAGTGGTGGGGAAGGAATGGGCAGTTCTGTGTGGGGACTGTCCCCT

GGTAACCCTGCCACAGGAAGTACCAATTGTGGGTTCAGTCAAGGGAATGGAGACACTGTGAACTCAGCATTAAGTGCTAAGCAGAACGGATCCAGCAGTG

CTGTGCAGAAGGAAGGGAATGGAGGGAACGCCTGGGACTCAGGGCCTCCTGCAGGGCCTGGCATCCTTGCCTGGGGAAGGGGCAGTGGCACCAATGGCAT

TGGTAATATCCATTCAGGAGCTTGGGGCCATCCCAGCCGAAGTTCTTCTAATGGTGTGAATGGGGAGTGGGGGAAGCCCCCAAACCAGCATTCCAGTAGT

GACATCAGTGGGAAAGGATCAACAGGGTGGGACAGTGCCAGTGCTGCCAGCCAGACCCCTGCCCTGCAGCCTGGCAGTGAACACATGAACTCGTGGGCCA

AAGCCACATCTTCTGGAACTACAGCAAGTGAAGGAAGCAGTGATGGGTCCGGCAATCACAATGAAGGAAGCACTGGGAGGGAAGGGACAGGAGAGGGCCG

GAGGCGAGACAAAGGGGTTCTAGACCAAGGGCACATCCAGTTGCCAAGGAATGACCTTGACCCAAGAGTTCTGTCTAACAGTGGTTGGGGACAGACTCCC

GTAAAGCAAAACACTGCCTGGGAATTTGAAGAGTCCCCTAGGTCTGAAAGGAAAAATGACAATGGGACAGAGGCCTGGGGTAGTATAGCTACTCAGCCTT

CAAACTCAGGGGGGAAGACTGATGGGTCCATCATGAACAGTACAAATACCTCTTCAGTATCGGGGTGGGTCAGCTCACCACCTGCCGCCGTGCCAGCAAA

CACAAGCTGGGGAGACAGCAACAACAAAGCGCCAAGTGGCCCAGGAGTTTGGGGGGACTCAATAAGCTCTACTGCTGTTAACAATGCTGCTGCCACCAAG

AGTGGCCATGCTTGGAGTGGGACTGTAAACCAAGAGGACAAATCACCCACCTGGGGTGAGCCTCAGAAGCCCAAATCCCAAAACTGGGGAGATGGACAAA

GAGCAAACCCAGCCTGGAGCACAGGGGCAGGAGACTGGGCAGATTCATCATCTGTCCTTGGACATCTAGGGGATGGAAAGAAAAATGGATCTGGATGGGA

TGCTGATGGTAATAGGTCAGGGTCTGGTTGGAATGATGCCACGAGATGTGGGACCAGTGGCTGGGGCAGTGGCACAAATGCTAAGGTGAATCCAGGTACA

AACTGGGGGGAGTCTCTCAAGCCTGGTCCCCAGCAGAACTGGGCTCATAAGCCCCAAGACAACAATGTGAGTAACTGGGGAGGAGCTGCTTCTGTTAAGC

AGACAGGGACAGGGTGGATTGGGGGGCCACTGCCAGTCAAGCAGAAGGACAGCAGTGAGGCGACTGGCTGGGAGGAGCCTTCCCCACCCTCCATCCGACG

CAAAATGGAAATTGATGATGGTACCTCAGCTTGGGGGGACCCAAGCACCTACAACAATAAAACTGTAAACATGTGGGACAGAAACAATCCAGTCATCCAG

AGCAGTACCACAGCCCCTGCCACCCCCACGACCCCCACCTCGAGCAGCACCACACACCGGGCCGAGACGCCGCCTTCACACCAGGCTGGCACTCAGCTGA

ATCGGTCACCACTGCTCGGGCCAG TTTCATCCGGCTGGGGAGAGATGCCCAGTGTTCACTCCAAGGCCGAGAACTCCTGGGGAGAGCCATCTTCCCCTT

GTACCCTGGTGGACAATGGCACAGCAGCGTGGGGGAAGCCTCCCAGCAGTGGCAGTGGGTGGGATCATCCTGCTGAGCCGGTGGTGCCATTTGGAAGAGC

CAGCGCTCCTGCTGCCGCCCCAGCCCTGTGCAAACCAG CTTCCAAATCTATGCAAGAAGGCTGGGGCAGCGGTGCGGATGAAATGAACCTGGGCACCAG

CCAGTGGGAGGATGAGGACGGGGACATGTGGAACAACGCTGCCTCCCAAGAAAGCAGCTCATCCTGCAGCTCCTGGGGCAACACCTCAAAAAAAGGACTT

CAGAAG GGCATGAAGACTCCTGGCAAGCAGGATGAGGCCTGGATCATGAGCCGGCTGATCAAACAACTCACAGACATGGGCTTCCCG AGAGAGCCAGC

CGAAGAGGCCTTGAAAAGCAACAGTATGAACCTTGACCAGGCCATGA GTGCTCTGCTGGAAAAGAAGGTGGACATGGACAAACGTGGACTGGGAATGAC

CGACTACAATGGAATGGTCACCAAACCCCTCGGCTGCCGCCCACCAATCTCCAAAGAGTCTTCCATGGACCGCCCCACCTTCCTTGACAAG CTCACCCT

TTCTTTCTCCAATCAGGATGGCGGCCTCGTGGAAGAGCCCACGACTTCACCGTTTTTGCCTTCCCCAAGCCTGAAGCTCCCCCTTTCCAACAGTGCACTC

CCCAGTCAGGCCCTGGGTGGGGTTGCCTCAGGGCTGGGCATGCAAAACTTGAACTCTTCTAGACAG ATCCCGAGTGGCAATCTGGGTGTGTTTGGCAAT

AGCGGAGCAGCACAAGCCAGGACCATGCAGCAGCCGCCAGTGCAGCCTCTTAATTCCTCCCAGCCCAGCCTCCGCGCTCAAGTGCCTCAGTTTCTATCCC

CTCAG GTTCAAGCACAGCTTTTGCAGTTTGCAGCAAAAAACATTGGTCTCAGCCCTGCACTATTAACCTCGCCAATTAACCCTCAGCATATGACGATGT

TGAACCAGCTCTATCAGCTGCAGCTG GCATACCAACGTTTACAAATCCAGCAGCAGATGTTACAGGCCCAGCGGAATGTTTCCGGACCCATGAGGCAAC

AGGAGCAGCAA GTTGCGCGCACAATCACTAATCTGCAGCAGCAGATCCAGCAGCACCAGCGCCAGCTGGCCCAGGCCCTGCTTGTAAAGCAGCCACCAC

CTCCGCCACCCCCGCCGCACCTGTCTCTGCACCCCTCTGCAGGCAAATCGGGCATGGAGAGCTTCCCCCCTCCCCCCCAGGCTCCCGGCCTTCCCGACCT

GCAGACCAAAGAGCAGCAGTCTTCACCCAACACCTTTGCTCCTTATCCTCTTG CTGGATTGAACCCGAACATGAATGTCAACAGCATAGACATGAGCAG

TGGCTTGTCTGTGAAGGACCCGTCGCAGTCCCAGTCACGCCTGCCTCAGTGGACACATCCCAACTCCATGGGTAACTTGTCTAGTGCTGCTTCTCCCCTG

GACCAGAATCCTAGCAAGCATG GTGCTATCCCTGGAGGTCTAAGCATCGGGCCTCCAGGTAAGTCCTCCATTGATGACTCTTACGGCCGGTACGATTTA

ATTCAGAACAGTGAGTCACCAGCCAGTCCTCCCGTAGCTGTTCCCCATAGCTGGTCACGTGCCAAATCTGACAGTGATAAAATCTCAAATGGCTCCAGCA

TCAGCTGGCCCCCAG AATTCCACCCTGGAGTTCCATGGAAAGGACTTCAGAACATTGACCCTGAGAATGACCCTGATGTCACGCCTGGCAGTGTCCCTA

CAGGACCTACCATCAACACCACCATCCAGGATGTCAACCGCTACCTCCTCAAGAGTGGAG GTAAGCTGTCTGATATTAAATCAACATGGTCCTCAGGCC

CAGCCTCTCACACGCAAGCCTCTCTGTCTCATGAGCTGTGGAAGGTACCCAGAAACACTACTGCACCCACCAGGCCGCCTCCAGGCTTAGCCAATCCCAA

GCCTTCCTCCACCTGGGGCACCAGCCCCCTCGGCTGGACCAGCTCCTACTCCTCGG GTTCTGCATGGAGCACTGACACCTCAGGAAGAACAAGCAGCTG

GCTCGTTCTGCGCAATCTCACACCCCAG ATCGATGGTTCTACACTTCGGACGCTGTGTCTGCAGCATGGACCTCTCATCACATTCCACCTGAACCTAAC

CCAGGGCAACGCTGTAGTCCGCTACAGTTCTAAGGAAGAAGCCGCCAAGGCCCAGAAGTCTCTGCACAT GTGTGTACTGGGAAACACCACCATCTTGGC

TGAGTTTGCCGGGGAAGAAGAAGTGAACCGGTTCCTGGCCCAAGGCCAAGCCCTCCCACCCACCTCCAGCTGGCAGTCCAGCAGCGGGGGCAGCCAGCCC

AGACTGGGCACCTCGGGCAGCACCCATGGCCTAGTGCGCAGCGACACTGCCCACTGGAACACCCCATGCCTGAGTGGCAAAGGCAGCAGTGAGCTGCTGT

GGGGTGGGGTCCCCCAGTACTCCAGCAGCCTGTGGGGCCCGCCCAGTGCTGAGGACGCCAGAGTGATCGGCAGCCCCACGCCTCTCAACACTCTGCTGCC

TGGGGACCTGCTCAGCGGCGAGTCCATCTAGGGGCCACGGTCACTGGGGGAAGAGAGCTGACCATGCCAGGGCCGGCTCCGAAGCTCCAGCTGACGGACA

AGCTGCCCCTTGGAGTACCTCTGTCCAGTCTGAAGATGAACCTTGGCCTCGGCCCCTGTGAACTGTTGAAGACAGTGCGGGCTGAGGTTGGTCAGTGTCA

TGTGCTAAGGACAGGACGTCTCTCATAGCTTTTTATTTCATGTCGTCTTAGGTTTGTACAGTGCGCTGCCATTTTGAGTTTTAAGTATAAAAGCTGCTTA

GAATAGTTCTATCATGAAGGGCACTTTTCAGATTGTGGGCTGGAAAGGGTTATTTTATGGTGGGGTGGGGGGAGACTTGAAGCCTATTTAAAGTGAGCCT

GTGACGATTATGCACATTACAGAGGCGGTAGGCGGGACAGGCGGCTGGGCTGCGTTGTGCGGGCACAGAGCTGAGGCGTGTGGCCAGTGCTCTGTCCCCC

CGATCGCCTGCGCACATTACCCTCGTTTCGTTACCTTTTCATGTCATTTTTTTTTATCCCAAAAAAATATTTTTTAAAAGTTAAAAAAAAAAAGACATAT

CAAACATGCAAATACTTGAACCCAGCAGGCCAATACCGAAATGTGAACACTTCCACGTTGACATCCGTGCACAGAAACAGGCTCTAGGAAATGTCTACGT

TCATAGCCTACATGTGCGTGTATGCGTGAGTGCGTGTGCTTGTGTGCTTGTGTGGTGCGGTGTGCAGAAGAGTGTGTGTGAGTGTGTTCTTGCACAGGCA

GGGCTTCCTGTGCGTGCGTGCGCACTTGAGTGTGTGAGGGACTTAACTGTGGGTTTCCCTTCTAGTCAGTATATGCTTTTGGTTTTGGTTTTTTTGGGGG

TTTTTGTTTTTGTTTGTTTTGTTTTTTGTTTTTGGCATTGGTCAAATGTTCTCATTGTTGTTATTTGCTTCTAACTTTGCACTGAGGTGTCTCTGCCCTT

CCTTTAGCTAATCCTAAACAGTAAAGAGAATTCTCGGGACAGGGCTGGTGACAATTCATGTGTAAATGTTTACTCAAGGACTCTGTTGTTGCATTTAAAG

TCGCAGTGTATATCTCTGGAGAAATGATGTGTCTGTCTACTTCAGCAGCTTGTCATTGTGGACTCATGCAGAAGATTATTACCAGAGTATTGCACCACTT

CCCATCTGCAATATAAAGTTAAAGAGAAAAACAAACTCTTGTTGAACTGTGGCCATAGATACTTGTAGAGACTGGTGCCGCGCACGAGGCGCGGGCGGGC

GGGCGGCCGGCCGAGCACTTGGACGTGGTGGTGACTGCTTTTGGAGGAGCTGTGTTTGGGCTCCCACCTGTTTACAGACTTTTTTTTTTTTTTTTTCCTC

CTTCAGACTTTAAAATAAAATTTTAAAAAAATTTTAAAAATGTTAAAAGGAATAAAAAAAAAAGACTTCCATCATTTAAAACAAACAAGCAAACAAACAG

CAACCTATTTTCAGATACAGATGTGTTGCTCCAGAGCTCTGGGATGGGACATGCTGTTCCCCTCCAGCCGTCGCGCGTGCGCGGACTCTGTGGACTGTCT

TCACCCCTCCTCAAGGTGACAGGGCCTCGTGGTCTCTGTCTTGCACACGCCAGCTCGCTCTCAGGAACGCCAGGGCTCCCGAGGGCGGTGCCACACCACT

TCATGTATTTTTAAACCCAACTCCTAGCACTGAAGATGTTATTTAAAAAAAAAAAAAAAAAAAAAGAGAGAGAAAAAAAAAGAAAGAAAAGAAAAAAACA

CACACACACACACAAAGAAGAAAAATACCTAATCTCTAATGTGTAGCAGTTACATATTTACCAAATAATGGACTCAAAAGAAATAGATGTTTGAAGAGTG

CTTTATATATTAAAAATTGCTTTATGTTTTAAAGATGATCAATGTTTTGATTGTTTTACAAGGAAGAAAGACAATGAAATCACACACCCTCAAGTATGTT

TTAGAAAAGTATATGAACATTGTACTCCCTGCCTACGTGGTCGGGAAACTTGTGCATTACATTTTTTAATTAGCTTTTTAATGGTTTTATCAAAACAGAA

AGCAAGCAAGCAAGTCCTGCACGGTTGCAGCAACGCAGTGCTTTCTTAGAGGATCAGGAACTATGCACAACTGGGTTCAAAACTTGTTCGAGTTTTGTTA

TGTATCCCACGGAATGGCCCTCCTCAGAGTGACTGCATCTCATCGCCATTACGTGCGTCCTAGATATTTGATGTATGTATATCCAAGTATGTATATCAAA

TACGTGCGTGTGCGCGCTCCCAGACGCACAGCTTGCCATGCTGCCATTTAGCACTGAGTTGTAGAAAAACTCATGTTTTAAAACTGGGGATGGAAGGAAA

AGATGTTCCCAGTTTTTGTGGGCTTTCCCCTCTTTTTCCTTTTTGATCCTTTTGAATTTTAAATGTCTCTGACTCTAAGATTAAAAGAAAAAGTTTGTGG

CGCTTAATGCCCTCCTCTTGGAATGTGATGGTTGGACGCACACCGGAGGTTGCTTTCGAAAAATAACAGCGCTTTGTTGAGTCTTAATAAACTGCAGTTT

TTCTTGGCTATTGATGTAA
Translation
 - UNI31092 - MEEKKKKKQEDKKKKEGAQKK - UNI25881 - AADQKTKV - UNI16511 - VPELTKTCSSQPQPAGTSPSTSTSTISSG

SNGKRASACGQQPAASRYLPREVPPRFRQQEQKQLLKRGQPLPTGGLTSLNSAQAAGPAGASPPPLPGAGAQQHPSKLQQD - UNI6583 - DLGHSG

LVDHYENSHWGQHPSYRSEANCSWDKVIIDRTEPEVWPSIPVTETESASECPTDTDSASNCGSENSSMATGSAQSSFPSHLKKTNGSHGTNGALVQSPSN

QSALGAGGTNGNGGVARVWGVATSSSSGLAHCSVGGGDGKMDNMIGDGRSQNCWGASNSNAGINLNLNPNANPAAWPVLGHEGTVATGNPSSICSPVSAI

GQNMGSQNGNPVGALGAWGNLLPQESAEPQTSTSQNVSFSVQPQNLNTDGPNNTNPMNSSPNPINAMQTNGLPNWGMAVGMGAIIPPHLQGLPGANGSSV

SQGSGSGGEGMGSSVWGLSPGNPATGSTNCGFSQGNGDTVNSALSAKQNGSSSAVQKEGNGGNAWDSGPPAGPGILAWGRGSGTNGIGNIHSGAWGHPSR

SSSNGVNGEWGKPPNQHSSSDISGKGSTGWDSASAASQTPALQPGSEHMNSWAKATSSGTTASEGSSDGSGNHNEGSTGREGTGEGRRRDKGVLDQGHIQ

LPRNDLDPRVLSNSGWGQTPVKQNTAWEFEESPRSERKNDNGTEAWGSIATQPSNSGGKTDGSIMNSTNTSSVSGWVSSPPAAVPANTSWGDSNNKAPSG

PGVWGDSISSTAVNNAAATKSGHAWSGTVNQEDKSPTWGEPQKPKSQNWGDGQRANPAWSTGAGDWADSSSVLGHLGDGKKNGSGWDADGNRSGSGWNDA

TRCGTSGWGSGTNAKVNPGTNWGESLKPGPQQNWAHKPQDNNVSNWGGAASVKQTGTGWIGGPLPVKQKDSSEATGWEEPSPPSIRRKMEIDDGTSAWGD

PSTYNNKTVNMWDRNNPVIQSSTTAPATPTTPTSSSTTHRAETPPSHQAGTQLNRSPLLGPV VSSGWGEMPSVHSKAENSWGEPSSPCTLVDNGTAAWG

KPPSSGSGWDHPAEPVVPFGRASAPAAAPALCKPA ASKSMQEGWGSGADEMNLGTSQWEDEDGDMWNNAASQESSSSCSSWGNTSKKGLQK GMKTPGK

QDEAWIMSRLIKQLTDMGFP REPAEEALKSNSMNLDQAMS SALLEKKVDMDKRGLGMTDYNGMVTKPLGCRPPISKESSMDRPTFLDK LTLSFSNQD

GGLVEEPTTSPFLPSPSLKLPLSNSALPSQALGGVASGLGMQNLNSSRQ IPSGNLGVFGNSGAAQARTMQQPPVQPLNSSQPSLRAQVPQFLSPQ VQA

QLLQFAAKNIGLSPALLTSPINPQHMTMLNQLYQLQL AYQRLQIQQQMLQAQRNVSGPMRQQEQQ VARTITNLQQQIQQHQRQLAQALLVKQPPPPPP

PPHLSLHPSAGKSGMESFPPPPQAPGLPDLQTKEQQSSPNTFAPYPLA AGLNPNMNVNSIDMSSGLSVKDPSQSQSRLPQWTHPNSMGNLSSAASPLDQ

NPSKHG GAIPGGLSIGPPGKSSIDDSYGRYDLIQNSESPASPPVAVPHSWSRAKSDSDKISNGSSISWPPE EFHPGVPWKGLQNIDPENDPDVTPGSV

PTGPTINTTIQDVNRYLLKSGG GKLSDIKSTWSSGPASHTQASLSHELWKVPRNTTAPTRPPPGLANPKPSSTWGTSPLGWTSSYSSG GSAWSTDTSG

RTSSWLVLRNLTPQ IDGSTLRTLCLQHGPLITFHLNLTQGNAVVRYSSKEEAAKAQKSLHM MCVLGNTTILAEFAGEEEVNRFLAQGQALPPTSSWQS

SSGGSQPRLGTSGSTHGLVRSDTAHWNTPCLSGKGSSELLWGGVPQYSSSLWGPPSAEDARVIGSPTPLNTLLPGDLLSGESI

For any suggestions or comments, please send an email to unitrap@crg.es