Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025579 (Gaa)
Chromosomal location
Chr 11: 119129340 - 119146768 (+)
Description
glucosidase, alpha, acid Gene [Source:MGI (curated);Acc:Gaa-002]
RefSeq_dna
NM_008064 
RefSeq_peptide
NP_032090.2 
UniGene
Mm.4793 Mm.406910 
MGI
MGI:95609 
Uniprot/SWISSPROT
P70699 
Uniprot/SPTREMBL
A2AFL3 A2AFL4 A2AFL5 A2AFL7 A2AFL6 
Human Ortholog
not available
Omim not available
UniTrap UNI34265
Vector Insertion
Chr 11: 119129537 - 119131401
Public Clones IST14216A10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000026666
Sequence
ACGTGACCCACGCTGCCCGCTGAGCCTGGGGGTCTTCGGCCTGGAGGGTGATTGCGCAGGTGAGCTGGGCGAGCTGGTGAAGGCTGTCTCCGGCCCCAGA

GCCTCCGGAGGAGCGGCCTCCTCCAGGCAGGCAGGGCCGACTGTCAGCGAGTTCCTGCTTTGGAGAATCGAGCAGAGACACGCGGCATAG - UNI3426

5 - GCCTTCAGAAGTATTCATGCTGCCCCGAACCAACAGGCTTTCACCATGAATATACGGAAGCCCCTCTGTTCGAACTCCGTGGTTGGGGCCTGCACC

CTTATCTCTCTGACTACAGCGGTCATCCTGGGTCATCTCATGCTTCGGGAGTTAATGCTGCTTCCCCAAGACCTTCATGAGTCCTCTTCAGGACTGTGGA

AGACGTACCGACCTCACCACCAGGAAGGTTACAAGCCAGGGCCTCTGCACATCCAGGAGCAGACTGAACAGCCCAAAGAAGCACCCACACAGTGTGATGT

GCCCCCCAGCAGCCGCTTTGACTGTGCCCCCGACAAAGGCATCTCACAGGAGCAATGCGAGGCCCGCGGCTGCTGCTATGTCCCAGCAGGGCAGGTGCTG

AAGGAGCCGCAGATAGGGCAGCCCTGGTGTTTCTTCCCTCCCAGCTACCCAAGCTACCGTCTAGAGAACCTGAGCTCTACAGAGTCGGGGTACACAGCCA

CCCTGACCCGTACCAGCCCGACCTTCTTCCCAAAGGATGTGCTGACCTTACAGCTGGAGGTGCTGATGGAGACAGACAGCCGCCTCCACTTCAAG ATCA

AAGATCCTGCTAGTAAGCGCTACGAAGTGCCCCTGGAGACCCCACGTGTGCTGAGCCAGGCACCATCCCCACTTTACAGCGTGGAATTCTCAGAGGAACC

CTTTGGAGTGATCGTTCGTAGGAAGCTTGGTGGCCGAGTGTT GCTGAACACAACCGTGGCCCCCCTGTTCTTCGCTGACCAGTTCCTGCAGCTGTCCAC

TTCCCTGCCCTCCCAGCACATCACAGGCCTGGGGGAACACCTCAGCCCACTCATGCTCAGCACCGACTGGGCTCGTATCACCCTCTGGAACCGGGACACA

CCACCCTCG CAAGGTACCAACCTCTACGGGTCACATCCTTTCTACCTGGCACTGGAGGACGGTGGCTTGGCTCACGGTGTCTTCTTGCTAAACAGCAAT

GCCATGG ATGTCATCCTGCAACCCAGCCCAGCCCTAACCTGGAGGTCAACGGGCGGGATCCTGGATGTGTATGTGTTCCTAGGCCCAGAGCCCAAGAGC

GTTGTGCAACAATACCTGGATGTTGTGG GATACCCCTTCATGCCTCCATACTGGGGCCTCGGCTTCCACCTCTGCCGCTGGGGCTACTCCTCGACCGCC

ATTGTCCGCCAGGTAGTGGAGAACATGACCAGGACACACTTCCCGCTG GACGTGCAATGGAATGACCTGGACTACATGGACGCCCGAAGAGACTTCACC

TTCAACCAGGACAGCTTTGCCGACTTCCCAGACATGGTGCGGGAGCTGCACCAGGATGGCCGGCGCTACATGATGATCGTG GACCCTGCCATCAGCAGC

GCAGGCCCTGCTGGGAGTTACAGGCCCTACGACGAGGGTCTGCGGAGGGGCGTGTTCATCACCAACGAGACTGGGCAGCCGCTGATTGGGAAG GTTTGG

CCTGGAACCACCGCCTTCCCTGATTTCACCAACCCTGAGACCCTTGACTGGTGGCAGGACATGGTGTCTGAGTTCCACGCCCAGGTGCCCTTCGATGGCA

TGTGGCTC GACATGAACGAACCGTCCAACTTCGTTAGAGGCTCTCAGCAGGGCTGCCCCAACAATGAACTGGAGAACCCCCCCTATGTGCCCG GGGTG

GTTGGCGGGATCTTGCAGGCAGCCACCATCTGTGCCTCCAGCCACCAATTCCTCTCCACACACTACAACCTCCACAACCTGTACGGCCTCACTGAAGCTA

TCGCCTCCAGCAG GGCCCTGGTCAAGACTCGGGGAACACGACCCTTTGTGATCTCCCGCTCAACCTTCTCGGGCCACGGCCGGTACGCTGGTCACTGGA

CAGGGGATGTGCGGAGCTCTTGGGAGCATCTTGCATACTCTGTGCCAG ACATCCTGCAGTTCAACCTGCTGGGCGTGCCCCTGGTCGGGGCGGACATCT

GCGGCTTCATAGGAGACACGTCAGAAGAGCTGTGTGTGCGCTGGACCCAGTTGGGGGCCTTCTACCCCTTCATGCGGAACCACAATGACCTGAATAGCGT

G CCTCAGGAGCCGTACAGGTTCAGCGAGACGGCGCAGCAGGCCATGAGGAAGGCCTTCGCCTTACGCTATGCCCTTCTGCCCTACCTGTACACTCTCTT

CCACCGCGCCCACGTCAGAGGAGACACGGTGGCCCGGCCCCTCTTCCTGGA GTTCCCTGAGGATCCCAGCACCTGGTCTGTGGACCGCCAGCTCTTGTG

GGGGCCGGCCCTGCTCATCACACCTGTGCTTGAGCCTGGGAAAACTGAAGTGACGGGCTACTTCCCCAAGGGCACGTGGTACAACATGCAGATG GTGTC

AGTGGATTCCCTCGGTACTCTCCCTTCTCCATCATCGGCTTCATCCTTCAGATCTGCTGTCCAGAGCAAGGGGCAGTGGCTGACACTGGAAGCCCCACTG

GATACCATCAACGTGCACCTGAGGGAGGGGTACATCATACCGCTGCAG GGTCCCAGCCTCACAACCACGGAGTCCCGAAAGCAGCCCATGGCTCTGGCT

GTGGCATTAACAGCAAGCGGCGAGGCCGATGGGGAGCTGTTCTGGGACGACGGGGAGAGCCTCGCGGTTCTGGAGCGTGGGGCCTACACACTGGTCACCT

TCTCAGCCAAGAAC AATACCATTGTGAACAAGTTAGTGCGTGTGACCAAGGAGGGAGCTGAGCTACAACTGAGGGAGGTGACCGTCTTGGGAGTGGCCA

CAGCTCCTACCCAGGTCCTTTCCAACGGCATCCCTGTCTCCAATTTCACCTACAGCCCTGACAACAAG AGCCTGGCCATCCCTGTCTCACTGCTGATGG

GAGAGCTGTTTCAAATCAGCTGGTCCTAGGAGAGTCCGTCGTTTACAGAGGCCTCCAGGGAGGCAGAGGGAGCTTGAGCTGGCTCTGGCTGGTGGCTCCT

GTAAGGACCTGCGTCCTGCTCTCCTGACACATCTTTGAGCTTTTCCCACCGTGTTACTGCATGCGCCCCTGAAGCTCTGTGTTCTTAGGAGAGTGAGGCT

CGCCTCACCTGCCCCACCCCAGCTGTCTGTCCCTCACCTGGCACTAGAGAATGTGGAGCTCGGCGTGGGGACATCGTGTCTGCACCAACATCAGGCTGTG

CAGCCACTGCAGCCGCAACCCTGCAGAGACAGAGCTGGTGCCTTCACCAGGTTCCCAAGACTCGAGAAACTTACTGTGAAGTGTACTTACTTTTAATAAA

AAGGATATTGTTTGGAAGC
Translation
 - UNI34265 - MNIRKPLCSNSVVGACTLISLTTAVILGHLMLRELMLLPQDLHESSSGLWKTYRPHHQEGYKPGPLHIQEQTEQPKEAPTQCDVPP

SSRFDCAPDKGISQEQCEARGCCYVPAGQVLKEPQIGQPWCFFPPSYPSYRLENLSSTESGYTATLTRTSPTFFPKDVLTLQLEVLMETDSRLHFK IKD

PASKRYEVPLETPRVLSQAPSPLYSVEFSEEPFGVIVRRKLGGRVL LLNTTVAPLFFADQFLQLSTSLPSQHITGLGEHLSPLMLSTDWARITLWNRDT

PPS QGTNLYGSHPFYLALEDGGLAHGVFLLNSNAMD DVILQPSPALTWRSTGGILDVYVFLGPEPKSVVQQYLDVVG GYPFMPPYWGLGFHLCRWGY

SSTAIVRQVVENMTRTHFPL DVQWNDLDYMDARRDFTFNQDSFADFPDMVRELHQDGRRYMMIV DPAISSAGPAGSYRPYDEGLRRGVFITNETGQPL

IGK VWPGTTAFPDFTNPETLDWWQDMVSEFHAQVPFDGMWL DMNEPSNFVRGSQQGCPNNELENPPYVPG GVVGGILQAATICASSHQFLSTHYNLH

NLYGLTEAIASSR RALVKTRGTRPFVISRSTFSGHGRYAGHWTGDVRSSWEHLAYSVPD DILQFNLLGVPLVGADICGFIGDTSEELCVRWTQLGAFY

PFMRNHNDLNSV PQEPYRFSETAQQAMRKAFALRYALLPYLYTLFHRAHVRGDTVARPLFLE EFPEDPSTWSVDRQLLWGPALLITPVLEPGKTEVTG

YFPKGTWYNMQM VSVDSLGTLPSPSSASSFRSAVQSKGQWLTLEAPLDTINVHLREGYIIPLQ GPSLTTTESRKQPMALAVALTASGEADGELFWDDG

ESLAVLERGAYTLVTFSAKN NTIVNKLVRVTKEGAELQLREVTVLGVATAPTQVLSNGIPVSNFTYSPDNK SLAIPVSLLMGELFQISWS
Transcript ENSMUST00000106259
Sequence
ACAGACCACGTGACCCACGCTGCCCGCTGAGCCTGGGGGTCTTCGGCCTGGAGGGTGATTGCGCAG - UNI34265 - GCCTTCAGAAGTATTCATGC

TGCCCCGAACCAACAGGCTTTCACCATGAATATACGGAAGCCCCTCTGTTCGAACTCCGTGGTTGGGGCCTGCACCCTTATCTCTCTGACTACAGCGGTC

ATCCTGGGTCATCTCATGCTTCGGGAGTTAATGCTGCTTCCCCAAGACCTTCATGAGTCCTCTTCAGGACTGTGGAAGACGTACCGACCTCACCACCAGG

AAGGTTACAAGCCAGGGCCTCTGCACATCCAGGAGCAGACTGAACAGCCCAAAGAAGCACCCACACAGTGTGATGTGCCCCCCAGCAGCCGCTTTGACTG

TGCCCCCGACAAAGGCATCTCACAGGAGCAATGCGAGGCCCGCGGCTGCTGCTATGTCCCAGCAGGGCAGGTGCTGAAGGAGCCGCAGATAGGGCAGCCC

TGGTGTTTCTTCCCTCCCAGCTACCCAAGCTACCGTCTAGAGAACCTGAGCTCTACAGAGTCGGGGTACACAGCCACCCTGACCCGTACCAGCCCGACCT

TCTTCCCAAAGGATGTGCTGACCTTACAGCTGGAGGTGCTGATGGAGACAGACAGCCGCCTCCACTTCAAG ATCAAAGATCCTGCTAGTAAGCGCTACG

AAGTGCCCCTGGAGACCCCACGTGTGCTGAGCCAGGCACCATCCCCACTTTACAGCGTGGAATTCTCAGAGGAACCCTTTGGAGTGATCGTTCGTAGGAA

GCTTGGTGGCCGAGTGTT GCTGAACACAACCGTGGCCCCCCTGTTCTTCGCTGACCAGTTCCTGCAGCTGTCCACTTCCCTGCCCTCCCAGCACATCAC

AGGCCTGGGGGAACACCTCAGCCCACTCATGCTCAGCACCGACTGGGCTCGTATCACCCTCTGGAACCGGGACACACCACCCTCG CAAGGTACCAACCT

CTACGGGTCACATCCTTTCTACCTGGCACTGGAGGACGGTGGCTTGGCTCACGGTGTCTTCTTGCTAAACAGCAATGCCATGG ATGTCATCCTGCAACC

CAGCCCAGCCCTAACCTGGAGGTCAACGGGCGGGATCCTGGATGTGTATGTGTTCCTAGGCCCAGAGCCCAAGAGCGTTGTGCAACAATACCTGGATGTT

GTGG GATACCCCTTCATGCCTCCATACTGGGGCCTCGGCTTCCACCTCTGCCGCTGGGGCTACTCCTCGACCGCCATTGTCCGCCAGGTAGTGGAGAAC

ATGACCAGGACACACTTCCCGCTG GACGTGCAATGGAATGACCTGGACTACATGGACGCCCGAAGAGACTTCACCTTCAACCAGGACAGCTTTGCCGAC

TTCCCAGACATGGTGCGGGAGCTGCACCAGGATGGCCGGCGCTACATGATGATCGTG GACCCTGCCATCAGCAGCGCAGGCCCTGCTGGGAGTTACAGG

CCCTACGACGAGGGTCTGCGGAGGGGCGTGTTCATCACCAACGAGACTGGGCAGCCGCTGATTGGGAAG GTTTGGCCTGGAACCACCGCCTTCCCTGAT

TTCACCAACCCTGAGACCCTTGACTGGTGGCAGGACATGGTGTCTGAGTTCCACGCCCAGGTGCCCTTCGATGGCATGTGGCTC GACATGAACGAACCG

TCCAACTTCGTTAGAGGCTCTCAGCAGGGCTGCCCCAACAATGAACTGGAGAACCCCCCCTATGTGCCCG GGGTGGTTGGCGGGATCTTGCAGGCAGCC

ACCATCTGTGCCTCCAGCCACCAATTCCTCTCCACACACTACAACCTCCACAACCTGTACGGCCTCACTGAAGCTATCGCCTCCAGCAG GGCCCTGGTC

AAGACTCGGGGAACACGACCCTTTGTGATCTCCCGCTCAACCTTCTCGGGCCACGGCCGGTACGCTGGTCACTGGACAGGGGATGTGCGGAGCTCTTGGG

AGCATCTTGCATACTCTGTGCCAG ACATCCTGCAGTTCAACCTGCTGGGCGTGCCCCTGGTCGGGGCGGACATCTGCGGCTTCATAGGAGACACGTCAG

AAGAGCTGTGTGTGCGCTGGACCCAGTTGGGGGCCTTCTACCCCTTCATGCGGAACCACAATGACCTGAATAGCGTG CCTCAGGAGCCGTACAGGTTCA

GCGAGACGGCGCAGCAGGCCATGAGGAAGGCCTTCGCCTTACGCTATGCCCTTCTGCCCTACCTGTACACTCTCTTCCACCGCGCCCACGTCAGAGGAGA

CACGGTGGCCCGGCCCCTCTTCCTGGA GTTCCCTGAGGATCCCAGCACCTGGTCTGTGGACCGCCAGCTCTTGTGGGGGCCGGCCCTGCTCATCACACC

TGTGCTTGAGCCTGGGAAAACTGAAGTGACGGGCTACTTCCCCAAGGGCACGTGGTACAACATGCAGATG GTGTCAGTGGATTCCCTCGGTACTCTCCC

TTCTCCATCATCGGCTTCATCCTTCAGATCTGCTGTCCAGAGCAAGGGGCAGTGGCTGACACTGGAAGCCCCACTGGATACCATCAACGTGCACCTGAGG

GAGGGGTACATCATACCGCTGCAG GGTCCCAGCCTCACAACCACGGAGTCCCGAAAGCAGCCCATGGCTCTGGCTGTGGCATTAACAGCAAGCGGCGAG

GCCGATGGGGAGCTGTTCTGGGACGACGGGGAGAGCCTCGCGGTTCTGGAGCGTGGGGCCTACACACTGGTCACCTTCTCAGCCAAGAAC AATACCATT

GTGAACAAGTTAGTGCGTGTGACCAAGGAGGGAGCTGAGCTACAACTGAGGGAGGTGACCGTCTTGGGAGTGGCCACAGCTCCTACCCAGGTCCTTTCCA

ACGGCATCCCTGTCTCCAATTTCACCTACAGCCCTGACAACAAG AGCCTGGCCATCCCTGTCTCACTGCTGATGGGAGAGCTGTTTCAAATCAGCTGGT

CCTAGGAGAGTCCGTCGTTTACAGAGGCCTCCAGGGAGGCAGAGGGAGCTTGAGCTGGCTCTGGCTGGTGGCTCCTGTAAGGACCTGCGTCCTGCTCTCC

TGACACATCTTTGAGCTTTTCCCACCGTGTTACTGCATGCGCCCCTGAAGCTCTGTGTTCTTAGGAGAGTGAGGCTCGCCTCACCTGCCCCACCCCAGCT

GTCTGTCCCTCACCTGGCACTAGAGAATGTGGAGCTCGGCGTGGGGACATCGTGTCTGCACCAACATCAGGCTGTGCAGCCACTGCAGCCGCAACCCTGC

AGAGACAGAGCTGGTGCCTTCACCAGGTTCCCAAGACTCGAGAAACTTACTGTGAAGTGTACTTACTTTTAATAAAAAGGATATTGTTTGGAAGC
Translation
 - UNI34265 - MNIRKPLCSNSVVGACTLISLTTAVILGHLMLRELMLLPQDLHESSSGLWKTYRPHHQEGYKPGPLHIQEQTEQPKEAPTQCDVPP

SSRFDCAPDKGISQEQCEARGCCYVPAGQVLKEPQIGQPWCFFPPSYPSYRLENLSSTESGYTATLTRTSPTFFPKDVLTLQLEVLMETDSRLHFK IKD

PASKRYEVPLETPRVLSQAPSPLYSVEFSEEPFGVIVRRKLGGRVL LLNTTVAPLFFADQFLQLSTSLPSQHITGLGEHLSPLMLSTDWARITLWNRDT

PPS QGTNLYGSHPFYLALEDGGLAHGVFLLNSNAMD DVILQPSPALTWRSTGGILDVYVFLGPEPKSVVQQYLDVVG GYPFMPPYWGLGFHLCRWGY

SSTAIVRQVVENMTRTHFPL DVQWNDLDYMDARRDFTFNQDSFADFPDMVRELHQDGRRYMMIV DPAISSAGPAGSYRPYDEGLRRGVFITNETGQPL

IGK VWPGTTAFPDFTNPETLDWWQDMVSEFHAQVPFDGMWL DMNEPSNFVRGSQQGCPNNELENPPYVPG GVVGGILQAATICASSHQFLSTHYNLH

NLYGLTEAIASSR RALVKTRGTRPFVISRSTFSGHGRYAGHWTGDVRSSWEHLAYSVPD DILQFNLLGVPLVGADICGFIGDTSEELCVRWTQLGAFY

PFMRNHNDLNSV PQEPYRFSETAQQAMRKAFALRYALLPYLYTLFHRAHVRGDTVARPLFLE EFPEDPSTWSVDRQLLWGPALLITPVLEPGKTEVTG

YFPKGTWYNMQM VSVDSLGTLPSPSSASSFRSAVQSKGQWLTLEAPLDTINVHLREGYIIPLQ GPSLTTTESRKQPMALAVALTASGEADGELFWDDG

ESLAVLERGAYTLVTFSAKN NTIVNKLVRVTKEGAELQLREVTVLGVATAPTQVLSNGIPVSNFTYSPDNK SLAIPVSLLMGELFQISWS
Transcript ENSMUST00000106258
Sequence
AGACCACGTGACCCACGCTGCCCGCTGAGCCTGGGGGTCTTCGGCCTGGAGGGTGATTGCGCAGGTGAGCTGGGCGAGCTGGTGAAGGCTGTCTCCGGCC

CCAGAGCCTCCGGAGGAGCGGCCTCCTCCAGGCAGGCAGGGCCGACTGTCAGCGAGTTCCTGCTTTGGAGAATCGAGCAGAGACACGCGGCATAG - UN

I34265 - GCCTTCAGAAGTATTCATGCTGCCCCGAACCAACAGGCTTTCACCATGAATATACGGAAGCCCCTCTGTTCGAACTCCGTGGTTGGGGCCT

GCACCCTTATCTCTCTGACTACAGCGGTCATCCTGGGTCATCTCATGCTTCGGGAGTTAATGCTGCTTCCCCAAGACCTTCATGAGTCCTCTTCAGGACT

GTGGAAGACGTACCGACCTCACCACCAGGAAGGTTACAAGCCAGGGCCTCTGCACATCCAGGAGCAGACTGAACAGCCCAAAGAAGCACCCACACAGTGT

GATGTGCCCCCCAGCAGCCGCTTTGACTGTGCCCCCGACAAAGGCATCTCACAGGAGCAATGCGAGGCCCGCGGCTGCTGCTATGTCCCAGCAGGGCAGG

TGCTGAAGGAGCCGCAGATAGGGCAGCCCTGGTGTTTCTTCCCTCCCAGCTACCCAAGCTACCGTCTAGAGAACCTGAGCTCTACAGAGTCGGGGTACAC

AGCCACCCTGACCCGTACCAGCCCGACCTTCTTCCCAAAGGATGTGCTGACCTTACAGCTGGAGGTGCTGATGGAGACAGACAGCCGCCTCCACTTCAAG

 ATCAAAGATCCTGCTAGTAAGCGCTACGAAGTGCCCCTGGAGACCCCACGTGTGCTGAGCCAGGCACCATCCCCACTTTACAGCGTGGAATTCTCAGAG

GAACCCTTTGGAGTGATCGTTCGTAGGAAGCTTGGTGGCCGAGTGTTGTGAGTTGGTTACCTGAGGCTTTGACTCCACCCTGAGTGGCCCCTTAGGGTCA

GAGCTTCTGCAATCAGCAAACCTGTCTACCTCATTCCAAACCCTGCCTTTTTCTGTCTTGTTTTCTGTTGCTGTGGTAAACACGAACAGAAGCCACGTGG

GGAAGAGAAAGTGGTTTACCTCACAGGTTCTAGGCCATGCTCCATCACTGCCGGGGCAGGAACTGAAGCAGAGGCCATGGAGGAGTGCTGTTTACTGCCT

TAGTCCTCATGGCTCACTTAGCTTAAGTTCTTATCCAGCCCAGAACTACCAGCCCTAGGGTGTTACCACCCTCAGTGAGCTAGGCCCCACCCACAACGAA

CTAGGCCCCACCCACAGTGAGCTAGGCCCCACCCACAACAAGCTAGGCCCCACCCACAGTGTGCTAGGCCCTCCCACATCAGTC
Translation
 - UNI34265 - MNIRKPLCSNSVVGACTLISLTTAVILGHLMLRELMLLPQDLHESSSGLWKTYRPHHQEGYKPGPLHIQEQTEQPKEAPTQCDVPP

SSRFDCAPDKGISQEQCEARGCCYVPAGQVLKEPQIGQPWCFFPPSYPSYRLENLSSTESGYTATLTRTSPTFFPKDVLTLQLEVLMETDSRLHFK IKD

PASKRYEVPLETPRVLSQAPSPLYSVEFSEEPFGVIVRRKLGGRVL
Transcript ENSMUST00000106256
Sequence
GCTATGTCCCAGCAGGGCAGGTGCTGAAGGAGCCGCAGATAGGGCAGCCCTGGTGTTTCTTCCCTCCCAGCTACCCAAGCTACCGTCTAGAGAACCTGAG

CTCTACAGAGTCGGGGTACACAGCCACCCTGACCCGTACCAGCCCGACCTTCTTCCCAAAGGATGTGCTGACCTTACAGCTGGAGGTGCTGATGGAGACA

GACAGCCGCCTCCACTTCAAG ATCAAAGATCCTGCTAGTAAGCGCTACGAAGTGCCCCTGGAGACCCCACGTGTGCTGAGCCAGGCACCATCCCCACTT

TACAGCGTGGAATTCTCAGAGGAACCCTTTGGAGTGATCGTTCGTAGGAAGCTTGGTGGCCGAGTGTT GCTGAACACAACCGTGGCCCCCCTGTTCTTC

GCTGACCAGTTCCTGCAGCTGTCCACTTCCCTGCCCTCCCAGCACATCACAGGCCTGGGGGAACACCTCAGCCCACTCATGCTCAGCACCGACTGGGCTC

GTATCACCCTCTGGAACCGGGACACACCACCCTCG CAAGGTACCAACCTCTACGGGTCACATCCTTTCTACCTGGCACTGGAGGACGGTGGCTTGGCTC

ACGGTGTCTTCTTGCTAAACAGCAATGCCATGG ATGTCATCCTGCAACCCAGCCCAGCCCTAACCTGGAGGTCAACGGGCGGGATCCTGGATGTGTATG

TGTTCCTAGGCCCAGAGCCCAAGAGCGTTGTGCAACAATACCTGGATGTTGTGG GATACCCCTTCATGCCTCCATACTGGGGCCTCGGCTTCCACCTCT

GCCGCTGGGGCTACTCCTCGACCGCCATTGTCCGCCAGGTAGTGGAGAACATGACCAGGACACACTTCCCGCTG GACGTGCAATGGAATGACCTGGACT

ACATGGACGCCCGAAGAGACTTCACCTTCAACCAGGACAGCTTTGCCGACTTCCCAGACATGGTGCGGGAGCTGCACCAGGATGGCCGGCGCTACATGAT

GATCGTG GCGGGATCCGCAGAACTGCTCTGCCTTAAAGCCTGCGGCAGGGGCCGTAACGAGCTGGTACTGAGCTGA
Translation
   MD DVILQPSPALTWRSTGGILDVYVFLGPEPKSVVQQYLDVVG GYPFMPPYWGLGFHLCRWGYSSTAIVRQVVENMTRTHFPL DVQWNDLDYMD

ARRDFTFNQDSFADFPDMVRELHQDGRRYMMIV AGSAELLCLKACGRGRNELVLS

For any suggestions or comments, please send an email to unitrap@crg.es