Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025583 (4932417H02Rik)
Chromosomal location
Chr 11: 119465012 - 119760904 (+)
Description
RIKEN cDNA 4932417H02 gene Gene [Source:MGI Symbol;Acc:MGI:1921620]
RefSeq_dna
NM_028898 
RefSeq_peptide
NP_083174.2 
UniGene
Mm.209933 
MGI
MGI:1921620 
Uniprot/SWISSPROT
Q8K4Q0 
Uniprot/SPTREMBL
A2ACM0 A4FUW1 A7MAY7 Q6ZPU3 
Human Ortholog
ENSG00000141564 (AC127496.5-201)
Omim not available
UniTrap UNI2866
Vector Insertion
Chr 11: 119465286 - 119518977
Public Clones AF0046 (sanger) RRG399 (baygenomics) RRO611 (baygenomics) D126C09 (ggtc)
(ggtc) D128H11 (ggtc) IST15082H3 (tigm) IST11578E11 (tigm) IST14826F3 (tigm)
IST14568F9 (tigm) IST11558B4 (tigm)
Private Clones OST468539 (lexicon) OST375213 (lexicon) OST201315 (lexicon) OST96784 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19723
Vector Insertion
Chr 11: 119519081 - 119532591
Public Clones D059A12 (ggtc) IST10090E1 (tigm)
Private Clones OST382847 (lexicon) OST77692 (lexicon) OST60663 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1601
Vector Insertion
Chr 11: 119532675 - 119586323
Public Clones CC0003 (sanger)
Private Clones OST293011 (lexicon) OST203138 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI856
Vector Insertion
Chr 11: 119586483 - 119605180
Public Clones CB0371 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18250
Vector Insertion
Chr 11: 119673335 - 119678391
Public Clones not available
Private Clones OST426950 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7689
Vector Insertion
Chr 11: 119684336 - 119704995
Public Clones RRS143 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8103
Vector Insertion
Chr 11: 119708259 - 119712640
Public Clones RRG059 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8098
Vector Insertion
Chr 11: 119712782 - 119717580
Public Clones RRG129 (baygenomics) RRG030 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9205
Vector Insertion
Chr 11: 119718768 - 119719149
Public Clones RRC102 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12713
Vector Insertion
Chr 11: 119719309 - 119726865
Public Clones F010B04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30551
Vector Insertion
Chr 11: 119735579 - 119746237
Public Clones IST12187G2 (tigm) IST12192D9BBR1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36995
Vector Insertion
Chr 11: 119746344 - 119748350
Public Clones CMHD-GT_537C5-3 (cmhd) CMHD-GT_537C5-5S (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9247
Vector Insertion
Chr 11: 119748466 - 119749855
Public Clones XG071 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9714
Vector Insertion
Chr 11: 119749981 - 119752427
Public Clones XG193 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38316
Vector Insertion
Chr 11: 119756320 - 119757216
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000026671
Sequence
AGCTTCCCGTTTTCCCGTATTTTATTTTACCAGTTCTGGTCCACACTAGTTTTTAAGGCTGGAGGTTCTCGAGCGCCTGCTGCCAAGGACTCCCCCTCCC

CCTCCTCCCCTGATGGAGTCGGAGATGCTGCAGTCGCCTCTTATGGGACTCGGGGAGGAAGATGAGGCGGACCTTACAGATTGGAACTTGCCTTTGGCTT

TTATGAAGAAAAGACATTGTGAGAAAATCGAAGGCTCCAAATCTTTAGCGCAGAGCTGGAGAATGAAGGATCGG - UNI2866 - ATGAAGACGGTGA

GTGTGGCCTTGGTCCTGTGCCTGAATGTGGGTGTGGATCCTCCGGATGTGGTGAAGACCACACCCTGTGCTCGGCTGGAATGCTGGATCG - UNI1972

3 - ATCCTCTGTCTATGGGCCCTCAGAAAGCTCTGGAAACCATCGGTGCAAACCTACAGAAGCAGTATGAGAACTGGCAGCCAAGG - UNI1601 - 

GCTCGGTACAAGCAGAGCCTCGACCCTACTGTGGATGAAGTCAAGAAACTTTGCACATCTCTGCGCCGGAACGCCAAGGAGGAACGGGTCCTTTTCCACT

ACAATGGCCACGGGGTGCCCAGGCCTACAGTGAATGGAGAGGTCTGGGTCTTCAACAAG - UNI856 - AACTACACTCAGTACATCCCTCTGTCCAT

ATACGACCTGCAGACGTGGATGGGCAGCCCATCCATCTTTGTCTACGACTGTTCCAATGCTGGCCTCATCGTCAAGTCCTTCAAACAGTTTGCACTGCAG

AGGGAGCAGGAACTAGAG GTAGCTGCGATTAACCCAAACCATCCACTTGCCCAGATGCCCTTGCCTCCCTCAATGAAAAACTGCATCCAGTTGGCAGCG

TGTGAGGCACACGAGCTGCTGCCCATGATCCCTGACCTCCCAGCCGACCTGTTCACATCCTGCCTCACCACTCCCATCAAGATTGCTCTGCGCTG GTTT

TGCATGCAGAAGTGCGTGAGTCTGGTGCCTGGAGTCACACTGGATTTGATAGAAAA GATCCCTGGCCGGCTGAATGACCGGAGGACCCCTCTGGGAGAG

CTGAACTGGATCTTCACAGCCATCACAGATACCATCGCCTGGAATGTGCTCCCTCGGG ATCTCTTCCAAAAGCTTTTCCGACAGGACCTGCTCGTGGCA

AGTTTGTTTAGAAATTTTTTATTGGCAGAAAGAATCATGAGGTCATATAACTGCACCCCAGTAAGCAGCCCGCGGCTCCCCCCGACATACATGCATGCCA

TGTG GCAGGCCTGGGACCTTGCTGTGGACATTTGCCTCTCTCAGCTGCCAACCATCATCGAAGAGGGTACTGCCTTCAGG - UNI18250 - CACAG

CCCATTCTTTGCCGAGCAGCTGACAGCATTCCAGGTGTGGCTCACAATGGGTGTGGAAAACAGGAGCCCCCCAGAGCAGCTGCCCATCGTCCTGCAG GT

GCTGCTAAGCCAGGTGCACCGGCTGAGAGCATTGGACTTGCTGGGACGGTTTTTGGACTTGGGCCCTTGGGCGGTGAGCTTG GCCCTGTCGGTGGGCAT

CTTCCCCTATGTACTGAAGCTGCTTCAGAGCTCAGCCCGAGAGCTTCGGCCACTCCTTGTCTTCATCTGGGCCAAAATCCTCGCTGTCGACAGT - UNI

7689 - TCGTGCCAAGCTGACCTCGTGAAGGACAACGGTCACAAGTACTTCCTATCCGTCTTGGCAGACCCATACATGCCA GCTGAACATAGGACCAT

GACAGCCTTCATTCTTGCTGTAATCGTCAACAGCTACACAACAGGGCAA GAGGCCTGCCTCCAGGGAAACCTGATTGCCATCTGTCTGGAGCAGCTCAG

CGACCCACACCCCTTGCTACGCCAGTGGGTGGCCATTTGCCTGGGAAGGATCTGGCAGAACTTCGACTCTGCAAGATGGTGTGGGGTGAGAGACAGTGCC

CACGAAAAGCTCTATAGCCTCCTCTCTGACCCCATCCCTGAG - UNI8103 - GTCCGATGTGCAGCTGTATTTGCCCTGGGCACCTTTGTGGGAAAT

TCTGCTGAGAGGACAGACCACTCTACCACCATTGACCACAATGTGGCCATGATGCTGGCTCAGCTGATCAATGATGGAAGCCCCATGGTCCGGAAG - U

NI8098 - GAGCTGGTGGTGGCTCTGAGTCACCTTGTAGTCCAATATGAAAGCAATTTCTGCACTGTGGCCCTGCAGTTCATGGAGGAAGAAAAGAACT

ACCCTTTGCCTTCTCCAGCAGCCACAG AGGGAGGGAGCTTGACCCCAGTTCGAGACAGCCCATGCACCCCCAGACTCCGTTCAGTGAGCTCCTATGGGA

ACATCCGAGCCGTCACGACAGCTAGGAACCTGAACAAATCTTTGCAGAATCTGAGCTTGACGGAAGAAT - UNI9205 - CGGGCAGCTCAGTGGCCT

TCTCTCCCGGGAACCTCAGCACCAGCAGCAGTGCCAGCAGCACCTTGGGGAGCCCTGAGAACGAGGAGTACATCCTGTCCTTCGAGACCATCGACAAGAT

GCGGCGTGTGAGCTCCTACTCAGCGCTCAACTCCCTCATAG - UNI12713 - GAGTTTCTTTTAATAGTGTTTACACTCAAATTTGGAGAGTCTTAC

TGCATCTGGCTGCTGATCCCTATCCAGATGTTTCTGATTTAGCCATGAAAGTCCTCAACAGCATTGCTTACAAG GCCACAGTGAACGCCCGGCCCCAAC

GAATCCTTGACACATCCTCTCTCACACAGTCGGCCCCAGCCAGCCCAACCAACAAGGGCATGCACATGCACCAGGTGGG AGGCTCCCCGCCAGCATCTA

GCACCAGCAGCTGCAGCCTGACCAATGATGTGGCCAAGCAGACTGTCAGCCGTGACCTGCCTTCCAGCCGCCCGGGTACTGCCGGCCCCACAGGGGCACA

GTACACCCCTCACTCCCACCAGTTCCCTCGAACACGAAAGATGTTTGACAAAGGCCCTGATCAG ACCACAGATGATGCAGATGATGCTGCCGGACACAA

GAGCTTCATTTGTGCCTCTATGCAGACAGGGTTCTGTGACTGGAGTGCCCGCTACTTTGCCCAGCCAGTCATGAAG - UNI30551 - ATCCCCGAGG

AGCATGACCTAGAGAGTCAGATCCGCAAGGAGCGTGAGTGGCGGTTCCTGAGGAACACTCGAGTCAGGAAGCAGGCTCAGCAGGTCATCCAGAAGG - U

NI36995 - GCATCACCAGACTGGACGATCAGATCTTTCTGAACAGGAACCCCGGCGTTCCTTCTGTGGTCAAATTCCATCCCTTTACACCATGCATAG

CTGTCGCCGACAAGGACAGCATCTG - UNI9247 - TTTTTGGGACTGGGAGAAAGGAGAGAAGCTGGACTATTTCCACAATGGCAACCCTCGGTACA

CCAGGGTCACCGCCATGGAGTACCTGAATGGTCAGGACTGTTCCTTGCTGCTGACAGCCACAG - UNI9714 - ATGATGGTGCCATCAGGGTCTGGA

AGAATTTTGCTGATTTGGAAAAGAATCCAGAGATGGTGACTGCGTGGCAAGGGCTCTCAGACATGCTTCCAACAACACGAG GAGCTGGGATGGTGGTAG

ACTGGGAACAAGAAACTGGCCTTCTCATGAGCTCAGGGGACGTGCGCATTGTCAGGATCTGGGATACTGACCGGGAGACGAAGGTGCAG GACATCCCCA

CGGGTGCTGACAGCTGTGTGACAAGTCTGTCTTGTGATTCGCACCGTTCGCTCATTGTGGCTGGCCTGGGTGATGGCTCGATCCGTGTCTACGACAGGAG

GATGGCACTCAGTGAATG CCGGGTCATGACTTACCGAGAGCACACAGCGTGGGTGGTAAAGGCCTACCTGCAGAAGCACCCTGAGGGCCACATCGTGAG

TGTGAG TGTCAATGGAGATGTGCGCTTCTTCGACCCTCGGATGCCCGAGTCTGTGAATGTAATGCAGATTGTGAAGGGGCTGACAGCCCTGGACATCCA

CCCCCAGGCAAACCTGATCGCCTG TGGCTCCATGAACCAGTTCACAGCCATCTACAACGGAAATGGAGAGCTGATCAACAACATCAAATACTATGATGG

CTTCATGGGCCAGCGAGTCGGGGCCATCAGCTGCCTGGCTTTCCACCCACACTGG CCTCATCTGGCCGTAGGAAGCAATGACTACTACATTTCCGTGTA

TTCGGTGGAGAAGCGTGTCAGATAGCGGCACCTAGGACCACTGCCAGGCCGCAGCCACCTCTGCTGTACATAGTGAGCCAGCCTGCACTGCTCGGATGCA

GTGCCCACCTACCCACCCACCTGCAAACCCCGGCTCCTGACTTGGCCGTGGCCAGCTGAGGAGGGGCTTGCACATCCTTCCTTCTGTCTTCACTATAACA

GCGTACAGGTCCAGAGCAGGGGAGGGGTTGGCCTGGCTTCCCATCAAGAACCAGCACCCAGGCACCAAGGACCTCCTCAGTGCAGCATGGTCCTTTCCTG

CCCTGTTTTCTTCTGAGGTTTTACAAAGGGACACATTTGATTTTTCCATGTGATCAAAGCATTAGTTACAGAGCAGACAGCGCCCTGTAGAATAGCCGTG

CTGGGGCTCCTAAGGGCCATGGCCCAGCCCCACTGTCCTCTCAGAGTGTGCTGCCAGTCCTGGGAAATGGATAAGAGCAATTGGGGGAAGAGAGAGGGTA

GAAGAGAGGGAAGGCCTCTCCTGCTACAAGGTATGGAAGTCTGAGCCTGGCCCTCCTGGAGCACCGAGGCAGTCCAGCACATTGTGTATGTCATGGTGCT

ATGAGGAAAGCTAGACCTCTGAGGTCCAGCCTGGCGGGCGCCCTCAAGTGAGCTAGCTGCAGGAGAGGGTCTGGTTCAGGGCAGATGAGGCAGATCTGTA

GTTAGCGGCTGCCTCCATCTATCAGGCATATTCTGAAGTGCTTCTCTCCCATAGGGCAGTAACAGTGGCCACAGGCCTGTCTCCTGCTTGTGCCACACAC

AGGTACACACGCATGCAGGCACGCAGCCTCCCCATCCATAATTACATGGATGCCCTGGTCTTCCTGCCCATGTACACTTAGGTGTGCATTCATGCAGGCC

CATAGTTTCCCCTCCTGCACATATATGGGCACTGTGGCCGGCCACATGCACGCACATGCTGGCCTCACCATGCATAGGGCTCAGACACTTCACTGAACTC

AGAGGCTGGAGGGCAGCATCAGCTCTGTTGATGGTGGAACTGAGGTTACATGATGCAGTATGTGCTGAGCACGAGTTCCACAGTGTCCTGGTGTGCCTGA

CACGTGTCTGCGTGCACAGGCAAGAGAGGACCATGGACACTGTAGCCCTAGATGTCAGCACTGTCCCCGTGTGTCCGACATGTGTCTGTGTGCACAGGCA

AGTGAGGACCTTAGGCACTGCAGCCCTGGATGGACCCAGCATTGCAGAGCAGTTGCACACAAACAGGACACAACACAATGATGTTTTGAAAAGCATTTTC

CGTTTTCCCTGGGAATCAGGATCTTTCAGAGGACAAGTGCCAACAGGAGCCCAGGGACACGGGTTGGGACATCTGTGGCAGAGGCTGGGTCCCTGTGCTG

TGTTCAGTGGACCTGTTTTAGCCAAGAGCATCTTCCCTGTGAGAGGATCCTACAGGCTGAGCTGTCCTGGGCAAGCAGAACAGGAGACCCTGGCACGGCC

CCTGGAAATGCATTCTCCCAACCGGGTGGGGCTCAAGGAAGCCAGCCCCTTGGTTGGGCCATAGAGCAGTGTGGCGACAGGAAGGCCCTAGAGCCACCTG

ACTTACCCCTGCTCAGTTCTGCAGAGAGCTTCAGGGGCTGAGTGTGCGTCAGCTCAGTCCTTGTCCAACTGGTGACTCAGTTTTGGCCGCACAGGGCCGC

CTGATGGGCTGGGCTGCTTCCCTGCCCTGGTGGAACCAGTGTTTGCATCTTGCCCACAGGCTGGGCCTCACAAGTCTGATGCGGAAATTCAATCATGAAG

CTAAGCAAAGCTCGAGAGAGCGCTGACCTAGAGCGCATTTCTCTATTTATTTTACCAAAATGAGAGTTGAAAGGACTGACAGGACACGGAACTGCAGTGG

CGTCCAGAGCAGTGACAGCAACAGAGTGTTAATAAAGAATAAAGCCGTGAGATGTCGCTGCCCTTGCCAGATGAGAATGGTGGGGTGGGGTGGCCCAAAG

GGCTGTGCCCTTGTGGCTTCTGCAGTCCCCGGGTCCCTGGGGTGAGACAGTCTTGGCCAGAGACAAGGCTACTCTATCTACCCCTCCAGGCCTGGGTGGA

AGTGAAGACATGCTGGTTGCCATGGAGATCTTG
Translation
MESEMLQSPLMGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDR - UNI2866 - MKTVSVALVLCLNVGVDPPDVVKTTPCARLECW

ID - UNI19723 - DPLSMGPQKALETIGANLQKQYENWQPR - UNI1601 - ARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPT

VNGEVWVFNK - UNI856 - NYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELE VAAINPNHPLAQMPLPPSMKNCIQLAAC

EAHELLPMIPDLPADLFTSCLTTPIKIALRW WFCMQKCVSLVPGVTLDLIEK KIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRD DLFQKLFRQD

LLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMW WQAWDLAVDICLSQLPTIIEEGTAFR - UNI18250 - HSPFFAEQLTAFQVWLTMGV

ENRSPPEQLPIVLQ VLLSQVHRLRALDLLGRFLDLGPWAVSL ALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDS - UNI7689 - SCQADL

VKDNGHKYFLSVLADPYMP AEHRTMTAFILAVIVNSYTTGQ EACLQGNLIAICLEQLSDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAHEKLYSL

LSDPIPE - UNI8103 - VRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPMVRK - UNI8098 - ELVVALSHLVVQYESNFCTV

ALQFMEEEKNYPLPSPAATE EGGSLTPVRDSPCTPRLRSVSSYGNIRAVTTARNLNKSLQNLSLTEES - UNI9205 - SGSSVAFSPGNLSTSSSA

SSTLGSPENEEYILSFETIDKMRRVSSYSALNSLIG - UNI12713 - GVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYK ATVNARPQR

ILDTSSLTQSAPASPTNKGMHMHQVG GGSPPASSTSSCSLTNDVAKQTVSRDLPSSRPGTAGPTGAQYTPHSHQFPRTRKMFDKGPDQ TTDDADDAAG

HKSFICASMQTGFCDWSARYFAQPVMK - UNI30551 - IPEEHDLESQIRKEREWRFLRNTRVRKQAQQVIQKG - UNI36995 - GITRLDDQI

FLNRNPGVPSVVKFHPFTPCIAVADKDSIC - UNI9247 - CFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQDCSLLLTATD - UNI9714 - D

DGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRG GAGMVVDWEQETGLLMSSGDVRIVRIWDTDRETKVQ DIPTGADSCVTSLSCDSHRSLIVAGLG

DGSIRVYDRRMALSEC CRVMTYREHTAWVVKAYLQKHPEGHIVSVS SVNGDVRFFDPRMPESVNVMQIVKGLTALDIHPQANLIAC CGSMNQFTAIY

NGNGELINNIKYYDGFMGQRVGAISCLAFHPHW PHLAVGSNDYYISVYSVEKRVR

For any suggestions or comments, please send an email to unitrap@crg.es