Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025656 (Arhgef9)
Chromosomal location
Chr X: 92244276 - 92392160 (-)
Description
CDC42 guanine nucleotide exchange factor (GEF) 9 Gene [Source:MGI (curated);Acc:Arhgef9-007]
Human Ortholog
not available
Omim not available
UniTrap UNI37830
Vector Insertion
Chr X: 92327536 - 92361310
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113871
Sequence
CCCAGTCAGCCCGCGACAACCCGCACCAGCCACCCGGCCTCACAGAAGCTGGACTTCGTGGACACCATGCAGTGGATTAGAGGCGGAACGGGAATG - U

NI37830 - CTGATCACTGGAGATTCCATCGTTAGTGCTGAGGCAGTATGGGATCACGTCACCATGGCCAACCGGGAGTTGGCATTTAAGGCTGGCGAC

GTCATCAAAGTCTTGGATGCTTCCAACAAGGATTGGTGGTGGGGCCAGATCGACGATGAGGAGGGATGGTTTCCTGCCAGCTTTGTGAGG CTCTGGGTG

AACCAGGAGGATGGGGTGGAGGAAGGGCCCAGTGATGTGCAGAATGGGCACCTGGACCCCAACTCAGACTGCCTTTGTCTGGGCCGGCCACTACAGAACC

GGGACCAGATGCGGGCCAATGTCATCAATGAGATCATGAGCACGGAGCGCCATTACATCAAGCACCTCAAGGACATTTGCGAG GGCTACCTGAAGCAGT

GCCGAAAGAGAAGGGACATGTTCAGTGACGAGCAGCTGAAGGTCATCTTTGGAAACATTGAAGACATATACAGATTTCAGATGGGCTTCGTGAGAGACCT

GGAGAAGCAGTACAACAATGATGATCCCCACCTCAGTGAGATAGGACCCTGCTTCTTAGAGCAT CAAGATGGATTCTGGATATACTCTGAATATTGTAA

CAACCACCTGGATGCCTGCATGGAACTCTCCAAGCTGATGAAGGACAGCCGCTATCAACACTTCTTTGAGGCCTGCCGCCTCTTGCAGCAGATGATCGAC

ATTGCTATTGATGGTTTTCTTTTGACTCCAGTACAGAAGATCTGCAAATATCCCTTACAATTGGCCGAGCTCCTAAAGTATACTGCCCAAGATCACAG T

GATTACAGATACGTTGCAGCTGCTTTGGCTGTCATGAGAAATGTGACTCAGCAGATCAATGAACGCAAGCGACGTCTGGAGAATATTGACAAGATTGCGC

AATGGCAGGCCTCTGTCCTAGACTGGGAG GGAGAGGACATCTTAGACAGGAGCTCGGAGCTGATCTACACTGGAGAGATGGCCTGGATCTACCAGCCCT

ATGGCCGCAACCAGCAGAGAGTCTTCTTCCTGTTTGACCACCAGATGGTCCTCTGCAAGAAG GACCTAATCCGGAGAGACATCCTATACTACAAGGGGC

GCATTGACATGGATAAATATGAGGTAATTGACATCGAAGATGGCAGAGATGATGACTTTAATGTCAGCATGAAAAATGCTTTCAAGCTTCATAACAAGGA

AACGGAAGAAGTGCATCTGTTCTTTGCCAAGAAACTGGAGGAGAAAATACGTTGGCTTAGAGCTTTCAGAGAAGAGAGAAAAATGGTACAAGAAGATGAA

AAAATTG GCTTTGAGATTTCTGAAAATCAGAAGAGACAGGCTGCAATGACTGTGAGAAAAGCTTCTAAACAGAAAGGTACTTCTGCCTTTACTCCTCCA

AACCCACTCACTGTCTGTGTGGGACTGGGAAACCATGGGGTATGTGTTTTCACATTCCTTGGCTCCTTTCTATACTGAGGTTCACTTGAAATAGTTTCCA

GCTACCCAGGTATTCTTGATAACAACTAACAAATGCTCTTAGTGTTTTGATTTTTGAGAGTAAGGGATGTGGGGTGGTCATATCTACGTTATTGGCTACA

TAAACAAAACAAAATTCAAAAAGTATTTTTGTGTTTACTTCAAAATAAGAAAAATTTCTTGAATAATCTAGAGAGAGGCAGGCAATAATGCATGTATATA

ATTTATTTAATAAACATAAATATATAGGGATTTGTTCTCAGCTTTCTTTCAGTGGTCTAAAAATGCTTACCTAATCAGTAGCCCCAAACCAAAGTGAAGA

GCCTCAAATTGAACAAAATAGTCTTTCTCCGAGGCATACATGGAAATGCCTTTGAAAAATTCAAATCCAAATAGAATCAGCTCAAATTTGAAATAGTTTT

TCTTTTCTTTTTCATGAATCAGAACAAAACTAAAGTGCTCAGTTGAGCAAAAAGAAGGAGCTCCCTTCCGCTTTCTAGAGTGTCTACGTAGTACCAAGTT

TCTTAATTTCTTTCATTTCATCTTTATAGTAACCCAAAGAAAATGGCACTATTAGCCCCTGTTCCAGGTTAAGAAACTGAAAACATTCAAGGTAAAGTGA

TTTTTCACCTGTCATCTTGATTCTGAGACCACTGCTCTCCCCTCTTCATCTCAGGGTCCTGATGATGGTAATATCTCTTGTTTGAAAAAAAGAGCTCATT

TGATTCTCTCATCTCAATTACTGGAAGCTATTTTTTACTGACAGTATTTTTACTGTTCCGAGGAATGGATAATCTTAATAAGACATCACTTTCCTCAGTC

CTTGCCTTCTGCTCTTTCATTAGCTCTAGGATTCTGAGTGAATTCTAGAAATAATGAAGGGAAAACTGATAAGATAGCTCTCATGCAAATGTCATTAGTT

AAGTAATTGTTCTAGTGTCCCCTTCACATGTTATTTGTAACACCATGGGACATTCATTATCAACCATCTATTTTTCTGAGGGAAGAGTTATCTGGCTGAT

AAAAAGGCCTTTTCACTTTACTTTGTTTACTTTCTGCTGTCTTGGTTTTCAGAATTTATATATAACTTCTTGGGGTTAAATGCTAATTTCCAATTCATCA

ACCCAATTGAATTTATCAATACAAACAATGTCAGAATCATAAACATAGCCCCCCATCTTCATAGACTTTAAGGTCAGTTGAAAATCAGATTATTTCTCTA

GAATAAATAAAACAATCTTGAAAAAATAAGAATGAAAAAGAAGTACCTAGTTCATCTAATTTCAACACTCATATAGTTCATTAACTGAGGCACTACAGAT

AGTTTAATAGAAAGAATTCAGAAATAGACCTACATGCATATGTGTGACTTATTTTTGACAAAGACAGAACAATTCAGCAAAGAAAGTGCAATATTTTCAA

CAAATAGTCTGAATTAGATTTCTATAGACAAATTTGGACCTTGATATAAGCCCAGACCTTTTATAATAATTAAGTAGGAATCTATTGTGAAATTAAATAC

GAAACTATAGCGCCCTAAGAAAAAGTATTCTAAAAATCTTTAGAGTTGGTATATTTGATATCAAAAGCTTGAAAGAGAAAATGAAAAATAGACTTTAAAG

CAGGAGTTCTTCCATGCTGTCCCTGTATTATTTGTTAGCATCTAATACCCTCATATTTCTAGCATTTGCCACCTTTCAAAAATGGCTACAGAACTGGAGG

CTTCTTCCTATGAAAGTACCAATGGCCCGTGATGGCTTAGCATTAAAACTACTGCCAGGGTAGTTGGATTCCTTGAATCCTCCATTAATATAAAAAGATC

TATAACCTCAGTATCATTGAAAGGTCACAGATTCCATTTCCCTTTTCTCTATGAAACATGTCTTATGGTGATGAATTTCCTTTCTGTTTCAACTACTAAT

GTCAATTTTCTATTGAATACAGGTTTGTCACTGTCAACCCAAAGCAAAATACTAAATTACTTGGGCCTTAACCGTTATGGAAAGTCCTGAAGTCAGTAGT

TCTTAACCAGATTATTTTGACGCTTTCAGGTAGGGTTGGAGAGGAAAAGAACCACAGTCTAAAACTGAAAAGAGTTTGTGAGGTTCTTCAGGGATATTAT

GGTCTCCTGAAAAGAAATCCTAACCAGGAACTCAGCACATGTGAGCTCTAGTTCCCACTTTATTGGGAGCTGAGTATAAGATCTTAGGTATAATATTTCT

TCTGTCCTTGGTTTTCTTGTCTGTCAAACAAATGATGGTAACACTCCAGATTTTATTTTTATTTTATTTTATTTTATTTTATTTTATTTTATTTGTGATA

CCTGATAAAATGGTGAAATAAATAGAATAAAAATAAGATGGTGAATAGAAATAGAGATATTGGTGCAAATATGACAAGGGAAAAAATTGCAGCACAGGTT

GATTATCATTTACCTGAAATGCTTGAGACACAATGTACCTCAGATTACAAATTGTATATATATATTTTTTTTATTTTGAAATATTTGTATAGACTTTCTA

CTTTCTATTAGATTTGAGAGTATTTCAGATTTTGGAATTAGGGTTATTCAATCCGTTACCAGGTAAAACTCACAAAACTAGTGTACTGTGAGTGATCACT

GTTCATTTGAAAATTCACTTGGTACTTAATTTATACTCTTTCCTTTGGTCTCCTATTTGCTCTAGGTGTCAACTCTGCCCGCTCAGTTCCTCCTTCCTAC

CCACCACCACAGGACCCGTTAAACCAGGGCCAGTACCTGGTCCCCGATGGCATCGCTCAGTCTCAAGTGTTTGAGTTCACTGAACCGAAACGCAGCCAGT

CACCATTCTGGCAAAACTTCAGTAGGTTAACCCCCTTCAAAAAATAATACCTATAGGAAGGCAGATAATTTTAAAATAAATAAAATTATATTTATAGATG

G
Translation
MQWIRGGTGM - UNI37830 - LITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVR LWVNQEDGVEEGPSD

VQNGHLDPNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIKHLKDICE GYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHL

SEIGPCFLEH QDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHS SDYRYVAAAL

AVMRNVTQQINERKRRLENIDKIAQWQASVLDWE GEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKK DLIRRDILYYKGRIDMDKYE

VIDIEDGRDDDFNVSMKNAFKLHNKETEEVHLFFAKKLEEKIRWLRAFREERKMVQEDEKIG GFEISENQKRQAAMTVRKASKQKGTSAFTPPNPLTVC

VGLGNHGVCVFTFLGSFLY
Transcript ENSMUST00000113873
Sequence
GAACTAGAAAGAGTAGGGGAGACTGAGACTGACCGGTAGCCAGCTAGGCAGACAGACGCATGCCCGGACAGACTCTGGAGAACCGATAGGTTCATTTTGC

CTTTCTTTTTGAAAAGCAGGATTTTGATTTTTCTGTGGCGCCCAAGAGAGAATGCTGGACTCTGCTACCTTCAGCTTAAGCTAAGATTTCTCAGTTAGGG

AGGAAAGATCAGCCCAGTCCCGAGAGGGGGAGGGAAGCAAAAGCCCCTGCCTCCAACCCCCTTCCCTCCCCCGGACCAAACTCGGGGACCAAACCCAGAC

CTTCCCTAACCATCTGACTTCCTCCTTTCCTTTTTAGCATGGTGGCTGTATGGACAGTCTGACAGAACAGAGATTGACATCTCCCAATCTGCCGGCCCCC

CACCTGGAACACTACAGTGTTCTGCATTGCACCATGACCCTGGATGTGCAAACTGTAGTCGTTTTTGCCGTGATTGTAGTCCTCCTGCTTGTCAATGTCA

TACTCATGTTTTTCTTGGGAACGCGCTGAATGGAGTCCAGCCACCTGAGCTGTTGCGAACTCTCACTTTGATTTCATCCCAAGAGCCTCTGAGGGGGAAA

AAATCAGGAGAGACAGTCTGAGACAGGGAAAGAGAGGGAGAAAAAGAACAAGCTTTCTTACTCAGGGGGGAAAACGTTTTGAGCTTCAACATGGCCTCGC

TGTGATAT - UNI37830 - CTCTGGGTGAACCAGGAGGATGGGGTGGAGGAAGGGCCCAGTGATGTGCAGAATGGGCACCTGGACCCCAACTCAGAC

TGCCTTTGTCTGGGCCGGCCACTACAGAACCGGGACCAGATGCGGGCCAATGTCATCAATGAGATCATGAGCACGGAGCGCCATTACATCAAGCACCTCA

AGGACATTTGCGAG GGCTACCTGAAGCAGTGCCGAAAGAGAAGGGACATGTTCAGTGACGAGCAGCTGAAGGTCATCTTTGGAAACATTGAAGACATAT

ACAGATTTCAGATGGGCTTCGTGAGAGACCTGGAGAAGCAGTACAACAATGATGATCCCCACCTCAGTGAGATAGGACCCTGCTTCTTAGAGCAT CAAG

ATGGATTCTGGATATACTCTGAATATTGTAACAACCACCTGGATGCCTGCATGGAACTCTCCAAGCTGATGAAGGACAGCCGCTATCAACACTTCTTTGA

GGCCTGCCGCCTCTTGCAGCAGATGATCGACATTGCTATTGATGGTTTTCTTTTGACTCCAGTACAGAAGATCTGCAAATATCCCTTACAATTGGCCGAG

CTCCTAAAGTATACTGCCCAAGATCACAG TGATTACAGATACGTTGCAGCTGCTTTGGCTGTCATGAGAAATGTGACTCAGCAGATCAATGAACGCAAG

CGACGTCTGGAGAATATTGACAAGATTGCGCAATGGCAGGCCTCTGTCCTAGACTGGGAG GGAGAGGACATCTTAGACAGGAGCTCGGAGCTGATCTAC

ACTGGAGAGATGGCCTGGATCTACCAGCCCTATGGCCGCAACCAGCAGAGAGTCTTCTTCCTGTTTGACCACCAGATGGTCCTCTGCAAGAAG GACCTA

ATCCGGAGAGACATCCTATACTACAAGGGGCGCATTGACATGGATAAATATGAGGTAATTGACATCGAAGATGGCAGAGATGATGACTTTAATGTCAGCA

TGAAAAATGCTTTCAAGCTTCATAACAAGGAAACGGAAGAAGTGCATCTGTTCTTTGCCAAGAAACTGGAGGAGAAAATACGTTGGCTTAGAGCTTTCAG

AGAAGAGAGAAAAATGGTACAAGAAGATGAAAAAATTG GCTTTGAGATTTCTGAAAATCAGAAGAGACAGGCTGCAATGACTGTGAGAAAAGCTTCTAA

ACAGAAAG GTGTCAACTCTGCCCGCTCAGTTCCTCCTTCCTACCCACCACCACAGGACCCGTTAAACCAGGGCCAGTACCTGGTCCCCGATGGCATCGC

TCAGTCTCAAGTGTTTGAGTTCACTGAACCGAAACGCAGCCAGTCACCATTCTGGCAAAACTTCAGTAGGTTAACCCCCTTCAAAAAATAATACCTATAG

GAAGGCAGATAATTTTAAAATAAATAAAAT
Translation
 - UNI37830 - MRANVINEIMSTERHYIKHLKDICE GYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCFLEH

 QDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHS SDYRYVAAALAVMRNVTQQI

NERKRRLENIDKIAQWQASVLDWE GEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKK DLIRRDILYYKGRIDMDKYEVIDIEDGRDD

DFNVSMKNAFKLHNKETEEVHLFFAKKLEEKIRWLRAFREERKMVQEDEKIG GFEISENQKRQAAMTVRKASKQKG GVNSARSVPPSYPPPQDPLNQG

QYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
Transcript ENSMUST00000113876
Sequence
GCCTGGAATCCCTTGAAGAGAGCTAGCAGACGAGAGAGATCTTAGGAAGCTGATGAACTAGAAAGAGTAGGGGAGACTGAGACTGACCGGTAGCCAGCTA

GGCAGACAGACGCATGCCCGGACAGACTCTGGAGAACCGATAGGTTCATTTTGCCTTTCTTTTTGAAAAGCAGGATTTTGATTTTTCTGTGGCGCCCAAG

AGAGAATGCTGGACTCTGCTACCTTCAGCTTAAGCTAAGATTTCTCAGTTAGGGAGGAAAGATCAGCCCAGTCCCGAGAGGGGGAGGGAAGCAAAAGCCC

CTGCCTCCAACCCCCTTCCCTCCCCCGGACCAAACTCGGGGACCAAACCCAGACCTTCCCTAACCATCTGACTTCCTCCTTTCCTTTTTAGCATGGTGGC

TGTATGGACAGTCTGACAGAACAGAGATTGACATCTCCCAATCTGCCGGCCCCCCACCTGGAACACTACAGTGTTCTGCATTGCACCATGACCCTGGATG

TGCAAACTGTAGTCGTTTTTGCCGTGATTGTAGTCCTCCTGCTTGTCAATGTCATACTCATGTTTTTCTTGGGAACGCGCTGAATGGAGTCCAGCCACCT

GAGCTGTTGCGAACTCTCACTTTGATTTCATCCCAAGAGCCTCTGAGGGGGAAAAAATCAGGAGAGACAGTCTGAGACAGGGAAAGAGAGGGAGAAAAAG

AACAAGCTTTCTTACTCAGGGGGGAAAACGTTTTGAGCTTCAACATGGCCTCGCTGTGATAT - UNI37830 - CTGATCACTGGAGATTCCATCGTT

AGTGCTGAGGCAGTATGGGATCACGTCACCATGGCCAACCGGGAGTTGGCATTTAAGGCTGGCGACGTCATCAAAGTCTTGGATGCTTCCAACAAGGATT

GGTGGTGGGGCCAGATCGACGATGAGGAGGGATGGTTTCCTGCCAGCTTTGTGAGG CTCTGGGTGAACCAGGAGGATGGGGTGGAGGAAGGGCCCAGTG

ATGTGCAGAATGGGCACCTGGACCCCAACTCAGACTGCCTTTGTCTGGGCCGGCCACTACAGAACCGGGACCAGATGCGGGCCAATGTCATCAATGAGAT

CATGAGCACGGAGCGCCATTACATCAAGCACCTCAAGGACATTTGCGAG GGCTACCTGAAGCAGTGCCGAAAGAGAAGGGACATGTTCAGTGACGAGCA

GCTGAAGGTCATCTTTGGAAACATTGAAGACATATACAGATTTCAGATGGGCTTCGTGAGAGACCTGGAGAAGCAGTACAACAATGATGATCCCCACCTC

AGTGAGATAGGACCCTGCTTCTTAGAGCAT CAAGATGGATTCTGGATATACTCTGAATATTGTAACAACCACCTGGATGCCTGCATGGAACTCTCCAAG

CTGATGAAGGACAGCCGCTATCAACACTTCTTTGAGGCCTGCCGCCTCTTGCAGCAGATGATCGACATTGCTATTGATGGTTTTCTTTTGACTCCAGTAC

AGAAGATCTGCAAATATCCCTTACAATTGGCCGAGCTCCTAAAGTATACTGCCCAAGATCACAG TGATTACAGATACGTTGCAGCTGCTTTGGCTGTCA

TGAGAAATGTGACTCAGCAGATCAATGAACGCAAGCGACGTCTGGAGAATATTGACAAGATTGCGCAATGGCAGGCCTCTGTCCTAGACTGGGAG GGAG

AGGACATCTTAGACAGGAGCTCGGAGCTGATCTACACTGGAGAGATGGCCTGGATCTACCAGCCCTATGGCCGCAACCAGCAGAGAGTCTTCTTCCTGTT

TGACCACCAGATGGTCCTCTGCAAGAAG GACCTAATCCGGAGAGACATCCTATACTACAAGGGGCGCATTGACATGGATAAATATGAGGTAATTGACAT

CGAAGATGGCAGAGATGATGACTTTAATGTCAGCATGAAAAATGCTTTCAAGCTTCATAACAAGGAAACGGAAGAAGTGCATCTGTTCTTTGCCAAGAAA

CTGGAGGAGAAAATACGTTGGCTTAGAGCTTTCAGAGAAGAGAGAAAAATGGTACAAGAAGATGAAAAAATTG GCTTTGAGATTTCTGAAAATCAGAAG

AGACAGGCTGCAATGACTGTGAGAAAAGCTTCTAAACAGAAAG GTGTCAACTCTGCCCGCTCAGTTCCTCCTTCCTACCCACCACCACAGGACCCGTTA

AACCAGGGCCAGTACCTGGTCCCCGATGGCATCGCTCAGTCTCAAGTGTTTGAGTTCACTGAACCGAAACGCAGCCAGTCACCATTCTGGCAAAACTTCA

GTAGGTTAACCCCCTTCAAAAAATAATACCTATAGGAAGGCAGATAATTTTAAAATAAATAAAATTATATTTATAGATGGACCTTTTTTTCGGAGAAGCA

CTGTTGAAAATTTATATATATATATATATATAAAATGTGTGTGTGTGAGAGAGAGTGAGTGTGTGTGTGTGCGTGTGTGTGCACACATACATGCACACAC

ACACACGCACACATAGACCTTTACGTATACACGTGTGTGTGTGGGCATGTGTGCACATATGCATGCACATGCATGCACACATACATACATATACACACAC

AGAGAAGGACCAAAACCATTTTCTGTTGTTTTGGGGAGTTGAAATCTGTAGTTGGTAAGAAGTACCACTGATTTCCAAACATGTAATCACTTCTTCAAAT

TTTTAGTTCTTAACCTTGTTTCCTCCCCCTTACTCTCTGTTATTTTTCCTGTTAAGATAACTTATTCGCTCCTCTAGTTCACTGACCTGTCATTATTACC

ATAGAGTATTTGCATTGTTTTATTTCCCTTTCCTTATGATACTGACGCTGATAACTTTTGAATTGAATTTATGTAGTGGGTTTGGGATTTCATTTCTCTC

CCTGTCACTTTCCACTGAGAAGGGGAGGATTCCCGTCTCCTGTTCCTCATGCACCCATCTGCAAATGTTCCTGTAGCCCTGCAGTTATACCAACAGCCTC

TTCCCAGCATCCTGTGTCCACAATTGTGCCAGTCTATACATGCTCTGTTGTGCCCTGTGACTTATCTGCTTGGTATTTCTATTGCTTTCACTGTTTTAGG

TATTGTGGAAGGATATAAAACCAAACAGAAACAAAGGAGTGAACGAATGTAATGAGAGTCGAGAAGATTTCTGTTAGGGGGATAGTTTTTATTTAGGTGA

TTTCTTCCCATATAACAGCAATGCTAAGCCATTGAAAGTTTCCACCTAAGAATTAGTTTGGGTCCATTAGTCTCTTTTCCAAGCCTCTTTTGTTATGGAT

CTCCTTTTCAGTCTATCTCTTCCCTAGGCAAAAGGTTTAACTAAACTAGTAGCAAAGAAATTGAGACTTTGCATCCTGGGGAAGAGATTTATCTCCACCC

CATAACTCATAGATGGTAGGTAGGTGTCAGGCAGGGCTCTCTTTATAGTGTTCTGGTAACCCCTGCTTCTGTTTTCAGATTCATAAGGCATCATTGTTAG

TAGTTTATGGAGGCGTTCAAGAGAAAAACCTGCTTGGCCAAGAGCATTAGCCACCTTCAGATTAACCTGAAAAGAGTTCAAGGTTGACAACAGCATCTTA

TAGAGACCATCAGGAAAAGAGAGAGGCTTGATCTAAGATAATATACCAGTAATTTGCATCACTGAAATTATAAGAAACATCCCCAATTGTTAGCAGATTG

CATGGATAATCTCTGTCTCCTTTTTTTGCCCTTACTGTCTTTCAGGTAGAGGATTGCGAGTATGGGATAGTTAGAGCCATTATGGCACTCAAAGCAGGCT

TTGTTCCAGACAGACTCCCATCCCAGGACAACTGAGGCAAGTGGTAGAGAAGCCTAGGGCTACTTTTACATCTGGGGGAAAAGAAAAGATCTGAGGTAGA

ACACTGAAGTTATTTCTTGGCAGGGTTTCCATTTGACCAGAATGTTTCCCACAAAAATCAGAATCCTCATGAGTACAAGAGTGCTTATTCTTTGTCATTT

AGCCCTTTCTATGGCTAGAGATTGGAGCAAGAACAATAGAATATAAAGAAGTGTGAAAACCCACCCTATCCAGGAATCTGGAGATTGTGTCTGTCCTGGA

CCTCACAAGAAAATACTTCATTATAAAAAAAAAAGATCTAAGCTTACCAAGTAGCAACCATAGCTGTATGAGGTCTTCAAAAAAGCTGAATTTGTACTTC

TTGACCTAGATTAAGCCCTACCCCTGAGAATCTTTCCCCTCTGAAAAACAAATTACACATTGTTGTCAGACTTTGTAGTTATCAAGGCTAACTAGCAGAA

TACCAGGGCTCGGGACTGGCTATCACTGCTCAGCATATGATAGAGCTACATAAGCCCTTATGGCAAGAAATCTGGCATCGAGCACATAGACTACAATGCT

CTCCCTTGGCAAACTGAAATGTGTTTCACTTCCTATGCAGGCCTCCCTTATTGCACCTTCATTTCCTACTTTCTACCCATTCTCACTAGGCTTGGCCTTG

GCAACTTTCTCCCAGGGTTAGGAGCACACCAGGAGGGCTTGTTTTGAAAGGTTTCTAGATCTATAGTATCTTTTGGCCAGACCTTCTCATTCTTTTCCCC

TTTCTGAGTCCAACATTCAAGGCTCCCAGATCAGGGGTATTACCTCTCATCATCCTGTTTCTCCATCCAGTCCACTAACCTTACAAGATGTAGTAATTTG

TGAAGGCACTACCAACTCCGCTCTCCTTGGATTGGAATGCCTGGCTCCACCCTCACACCTACAGCTCCAAATAGATCAGTGGCCAGTAGCCCAAAGGGAA

ACTCATCAATTCCCTGGACTCAGTAGCTGAACCTGCTGCAGCCCCACGGCCATATAATCCCCCCCAAAAATAACTCTATACTTCTCCTGTTTCTGCATGG

CCCCAGACTCCCCTTTCCTCAACTCAATGAGGCCCGAACTTTCTTTCTCCAGTTTTGTGAGTTTGTTCTATGAGTTCTATTATAGGGAGGTCCTAAATAC

AGAAATACAATTTTTCTCTCCTTCTCTCATCCACTTTCTATGTGTATATCTTTAATTGATCTATTAAGGACAGCAGCAAGAGAGTTCTAACAATTCTAGT

ATGAAGCCAAATAGTGCTATTTTAGTGCTTTGGGGGTGGGGCGGGCTGGGTGACTAGATGGGCAACAGTGATTTTGACCCCTGCTGCTCTGCATTTGCCG

GCTTATTCTTTTGTTTCTATTATCCGACTGTTTGACCCTGTCAAACAAGTGTCAAAATTGTGTATTTGGAAATGTTTAACAACAACAACAACAAAAAAGA

TGTTGTAATGACATAAAGCCTTATGAAAATATTTATGGAGTTCAATAAAAGAAGTAAAAAAG
Translation
 - UNI37830 - MANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVR LWVNQEDGVEEGPSDVQNGHLDPNSDCLCLGRPLQNRDQMRAN

VINEIMSTERHYIKHLKDICE GYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCFLEH QDGFWIYSEYCNNHLDA

CMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHS SDYRYVAAALAVMRNVTQQINERKRRLENIDKIAQWQA

SVLDWE GEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKK DLIRRDILYYKGRIDMDKYEVIDIEDGRDDDFNVSMKNAFKLHNKETE

EVHLFFAKKLEEKIRWLRAFREERKMVQEDEKIG GFEISENQKRQAAMTVRKASKQKG GVNSARSVPPSYPPPQDPLNQGQYLVPDGIAQSQVFEFTE

PKRSQSPFWQNFSRLTPFKK
Transcript ENSMUST00000113878
Sequence
GTCAGAGACTCACGCTGGCGCCCCCAGTTTCTGCGTGAATAAAAAGGCAACCTACCGGCTGAG - UNI37830 - CATGGTGGCTGTATGGACAGTCT

GACAGAACAGAGATTGACATCTCCCAATCTGCCGGCCCCCCACCTGGAACACTACAGTGTTCTGCATTGCACCATGACCCTGGATGTGCAAACTGTAGTC

GTTTTTGCCGTGATTGTAGTCCTCCTGCTTGTCAATGTCATACTCATGTTTTTCTTGGGAACGCGCTGAATGGAGTCCAGCCACCTGAGCTGTTGCGAAC

TCTCACTTTGATTTCATCCCAAGAGCCTCTGAGGGGGAAAAAATCAGGAGAGACAGTCTGAGACAGGGAAAGAGAGGGAGAAAAAGAACAAGCTTTCTTA

CTCAGGGGGGAAAACGTTTTGAGCTTCAACATGGCCTCGCTGTGATATGTATGAC - UNI37830 - CTGATCACTGGAGATTCCATCGTTAGTGCTG

AGGCAGTATGGGATCACGTCACCATGGCCAACCGGGAGTTGGCATTTAAGGCTGGCGACGTCATCAAAGTCTTGGATGCTTCCAACAAGGATTGGTGGTG

GGGCCAGATCGACGATGAGGAGGGATGGTTTCCTGCCAGCTTTGTGAGG CTCTGGGTGAACCAGGAGGATGGGGTGGAGGAAGGGCCCAGTGATGTGCA

GAATGGGCACCTGGACCCCAACTCAGACTGCCTTTGTCTGGGCCGGCCACTACAGAACCGGGACCAGATGCGGGCCAATGTCATCAATGAGATCATGAGC

ACGGAGCGCCATTACATCAAGCACCTCAAGGACATTTGCGAG GGCTACCTGAAGCAGTGCCGAAAGAGAAGGGACATGTTCAGTGACGAGCAGCTGAAG

GTCATCTTTGGAAACATTGAAGACATATACAGATTTCAGATGGGCTTCGTGAGAGACCTGGAGAAGCAGTACAACAATGATGATCCCCACCTCAGTGAGA

TAGGACCCTGCTTCTTAGAGCAT CAAGATGGATTCTGGATATACTCTGAATATTGTAACAACCACCTGGATGCCTGCATGGAACTCTCCAAGCTGATGA

AGGACAGCCGCTATCAACACTTCTTTGAGGCCTGCCGCCTCTTGCAGCAGATGATCGACATTGCTATTGATGGTTTTCTTTTGACTCCAGTACAGAAGAT

CTGCAAATATCCCTTACAATTGGCCGAGCTCCTAAAGTATACTGCCCAAGATCACAG TGATTACAGATACGTTGCAGCTGCTTTGGCTGTCATGAGAAA

TGTGACTCAGCAGATCAATGAACGCAAGCGACGTCTGGAGAATATTGACAAGATTGCGCAATGGCAGGCCTCTGTCCTAGACTGGGAG GGAGAGGACAT

CTTAGACAGGAGCTCGGAGCTGATCTACACTGGAGAGATGGCCTGGATCTACCAGCCCTATGGCCGCAACCAGCAGAGAGTCTTCTTCCTGTTTGACCAC

CAGATGGTCCTCTGCAAGAAG GACCTAATCCGGAGAGACATCCTATACTACAAGGGGCGCATTGACATGGATAAATATGAGGTAATTGACATCGAAGAT

GGCAGAGATGATGACTTTAATGTCAGCATGAAAAATGCTTTCAAGCTTCATAACAAGGAAACGGAAGAAGTGCATCTGTTCTTTGCCAAGAAACTGGAGG

AGAAAATACGTTGGCTTAGAGCTTTCAGAGAAGAGAGAAAAATGGTACAAGAAGATGAAAAAATTG GCTTTGAGATTTCTGAAAATCAGAAGAGACAGG

CTGCAATGACTGTGAGAAAAGCTTCTAAACAGAAAG GTGTCAACTCTGCCCGCTCAGTTCCTCCTTCCTACCCACCACCACAGGACCCGTTAAACCAGG

GCCAGTACCTGGTCCCCGATGGCATCGCTCAGTCTCAAGTGTTTGAGTTCACTGAACCGAAACGCAGCCAGTCACCATTCTGGCAAAACTTCAGTAGGTT

AACCCCCTTCAAAAAATAATACCTATAGGAAGGCAGATAATTTTAAAATAAATAAAATTATATTTATAGATGGACCTTTTTTTCGGAGAAGCACTGTTGA

AAATTTATATATATATATATATATAAAATGTGTGTGTGTGAGAGAGAGTGAGTGTGTGTGTGTGCGTGTGTGTGCACACATACATGCACACACACACACG

CACACATAGACCTTTACGTATACACGTGTGTGTGTGGGCATGTGTGCACATATGCATGCACATGCATGCACACATACATACATATACACACACAGAGAAG

GACCAAAACCATTTTCTGTTGTTTTGGGGAGTTGAAATCTGTAGTTGGTAAGAAGTACCACTGATTTCCAAACATGTAATCACTTCTTCAAATTTTTAGT

TCTTAACCTTGTTTCCTCCCCCTTACTCTCTGTTATTTTTCCTGTTAAGATAACTTATTCGCTCCTCTAGTTCACTGACCTGTCATTATTACCATAGAGT

ATTTGCATTGTTTTATTTCCCTTTCCTTATGATACTGACGCTGATAACTTTTGAATTGAATTTATGTAGTGGGTTTGGGATTTCATTTCTCTCCCTGTCA

CTTTCCACTGAGAAGGGGAGGATTCCCGTCTCCTGTTCCTCATGCACCCATCTGCAAATGTTCCTGTAGCCCTGCAGTTATACCAACAGCCTCTTCCCAG

CATCCTGTGTCCACAATTGTGCCAGTCTATACATGCTCTGTTGTGCCCTGTGACTTATCTGCTTGGTATTTCTATTGCTTTCACTGTTTTAGGTATTGTG

GAAGGATATAAAACCAAACAGAAACAAAGGAGTGAACGAATGTAATGAGAGTCGAGAAGATTTCTGTTAGGGGGATAGTTTTTATTTAGGTGATTTCTTC

CCATATAACAGCAATGCTAAGCCATTGAAAGTTTCCACCTAAGAATTAGTTTGGGTCCATTAGTCTCTTTTCCAAGCCTCTTTTGTTATGGATCTCCTTT

TCAGTCTATCTCTTCCCTAGGCAAAAGGTTTAACTAAACTAGTAGCAAAGAAATTGAGACTTTGCATCCTGGGGAAGAGATTTATCTCCACCCCATAACT

CATAGATGGTAGGTAGGTGTCAGGCAGGGCTCTCTTTATAGTGTTCTGGTAACCCCTGCTTCTGTTTTCAGATTCATAAGGCATCATTGTTAGTAGTTTA

TGGAGGCGTTCAAGAGAAAAACCTGCTTGGCCAAGAGCATTAGCCACCTTCAGATTAACCTGAAAAGAGTTCAAGGTTGACAACAGCATCTTATAGAGAC

CATCAGGAAAAGAGAGAGGCTTGATCTAAGATAATATACCAGTAATTTGCATCACTGAAATTATAAGAAACATCCCCAATTGTTAGCAGATTGCATGGAT

AATCTCTGTCTCCTTTTTTTGCCCTTACTGTCTTTCAGGTAGAGGATTGCGAGTATGGGATAGTTAGAGCCATTATGGCACTCAAAGCAGGCTTTGTTCC

AGACAGACTCCCATCCCAGGACAACTGAGGCAAGTGGTAGAGAAGCCTAGGGCTACTTTTACATCTGGGGGAAAAGAAAAGATCTGAGGTAGAACACTGA

AGTTATTTCTTGGCAGGGTTTCCATTTGACCAGAATGTTTCCCACAAAAATCAGAATCCTCATGAGTACAAGAGTGCTTATTCTTTGTCATTTAGCCCTT

TCTATGGCTAGAGATTGGAGCAAGAACAATAGAATATAAAGAAGTGTGAAAACCCACCCTATCCAGGAATCTGGAGATTGTGTCTGTCCTGGACCTCACA

AGAAAATACTTCATTATAAAAAAAAAAGATCTAAGCTTACCAAGTAGCAACCATAGCTGTATGAGGTCTTCAAAAAAGCTGAATTTGTACTTCTTGACCT

AGATTAAGCCCTACCCCTGAGAATCTTTCCCCTCTGAAAAACAAATTACACATTGTTGTCAGACTTTGTAGTTATCAAGGCTAACTAGCAGAATACCAGG

GCTCGGGACTGGCTATCACTGCTCAGCATATGATAGAGCTACATAAGCCCTTATGGCAAGAAATCTGGCATCGAGCACATAGACTACAATGCTCTCCCTT

GGCAAACTGAAATGTGTTTCACTTCCTATGCAGGCCTCCCTTATTGCACCTTCATTTCCTACTTTCTACCCATTCTCACTAGGCTTGGCCTTGGCAACTT

TCTCCCAGGGTTAGGAGCACACCAGGAGGGCTTGTTTTGAAAGGTTTCTAGATCTATAGTATCTTTTGGCCAGACCTTCTCATTCTTTTCCCCTTTCTGA

GTCCAACATTCAAGGCTCCCAGATCAGGGGTATTACCTCTCATCATCCTGTTTCTCCATCCAGTCCACTAACCTTACAAGATGTAGTAATTTGTGAAGGC

ACTACCAACTCCGCTCTCCTTGGATTGGAATGCCTGGCTCCACCCTCACACCTACAGCTCCAAATAGATCAGTGGCCAGTAGCCCAAAGGGAAACTCATC

AATTCCCTGGACTCAGTAGCTGAACCTGCTGCAGCCCCACGGCCATATAATCCCCCCCAAAAATAACTCTATACTTCTCCTGTTTCTGCATGGCCCCAGA

CTCCCCTTTCCTCAACTCAATGAGGCCCGAACTTTCTTTCTCCAGTTTTGTGAGTTTGTTCTATGAGTTCTATTATAGGGAGGTCCTAAATACAGAAATA

CAATTTTTCTCTCCTTCTCTCATCCACTTTCTATGTGTATATCTTTAATTGATCTATTAAGGACAGCAGCAAGAGAGTTCTAACAATTCTAGTATGAAGC

CAAATAGTGCTATTTTAGTGCTTTGGGGGTGGGGCGGGCTGGGTGACTAGATGGGCAACAGTGATTTTGACCCCTGCTGCTCTGCATTTGCCGGCTTATT

CTTTTGTTTCTATTATCCGACTGTTTGACCCTGTCAAACAAGTGTCAAAATTGTGTATTTGGAAATGTTTAACAACAACAACAACAAAAAAGATGTTGTA

ATGACATAAAGCCTTATGAAAATATTTATGGAGTTCAATAAAAGAAGT
Translation
 - UNI37830 -  - UNI37830 - MANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVR LWVNQEDGVEEGPSDVQNGHLDPNSDCLC

LGRPLQNRDQMRANVINEIMSTERHYIKHLKDICE GYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCFLEH QDG

FWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHS SDYRYVAAALAVMRNVTQQINERK

RRLENIDKIAQWQASVLDWE GEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKK DLIRRDILYYKGRIDMDKYEVIDIEDGRDDDFNV

SMKNAFKLHNKETEEVHLFFAKKLEEKIRWLRAFREERKMVQEDEKIG GFEISENQKRQAAMTVRKASKQKG GVNSARSVPPSYPPPQDPLNQGQYLV

PDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
Transcript ENSMUST00000113880
Sequence
ATGACCCAG CTGATCACTGGAGATTCCATCGTTAGTGCTGAGGCAGTATGGGATCACGTCACCATGGCCAACCGGGAGTTGGCATTTAAGGCTGGCGAC

GTCATCAAAGTCTTGGATGCTTCCAACAAGGATTGGTGGTGGGGCCAGATCGACGATGAGGAGGGATGGTTTCCTGCCAGCTTTGTGAGG CTCTGGGTG

AACCAGGAGGATGGGGTGGAGGAAGGGCCCAGTGATGTGCAGAATGGGCACCTGGACCCCAACTCAGACTGCCTTTGTCTGGGCCGGCCACTACAGAACC

GGGACCAGATGCGGGCCAATGTCATCAATGAGATCATGAGCACGGAGCGCCATTACATCAAGCACCTCAAGGACATTTGCGAG GGCTACCTGAAGCAGT

GCCGAAAGAGAAGGGACATGTTCAGTGACGAGCAGCTGAAGGTCATCTTTGGAAACATTGAAGACATATACAGATTTCAGATGGGCTTCGTGAGAGACCT

GGAGAAGCAGTACAACAATGATGATCCCCACCTCAGTGAGATAGGACCCTGCTTCTTAGAGCAT CAAGATGGATTCTGGATATACTCTGAATATTGTAA

CAACCACCTGGATGCCTGCATGGAACTCTCCAAGCTGATGAAGGACAGCCGCTATCAACACTTCTTTGAGGCCTGCCGCCTCTTGCAGCAGATGATCGAC

ATTGCTATTGATGGTTTTCTTTTGACTCCAGTACAGAAGATCTGCAAATATCCCTTACAATTGGCCGAGCTCCTAAAGTATACTGCCCAAGATCACAG T

GATTACAGATACGTTGCAGCTGCTTTGGCTGTCATGAGAAATGTGACTCAGCAGATCAATGAACGCAAGCGACGTCTGGAGAATATTGACAAGATTGCGC

AATGGCAGGCCTCTGTCCTAGACTGGGAG GGAGAGGACATCTTAGACAGGAGCTCGGAGCTGATCTACACTGGAGAGATGGCCTGGATCTACCAGCCCT

ATGGCCGCAACCAGCAGAGAGTCTTCTTCCTGTTTGACCACCAGATGGTCCTCTGCAAGAAG GACCTAATCCGGAGAGACATCCTATACTACAAGGGGC

GCATTGACATGGATAAATATGAGGTAATTGACATCGAAGATGGCAGAGATGATGACTTTAATGTCAGCATGAAAAATGCTTTCAAGCTTCATAACAAGGA

AACGGAAGAAGTGCATCTGTTCTTTGCCAAGAAACTGGAGGAGAAAATACGTTGGCTTAGAGCTTTCAGAGAAGAGAGAAAAATGGTACAAGAAGATGAA

AAAATTG GCTTTGAGATTTCTGAAAATCAGAAGAGACAGGCTGCAATGACTGTGAGAAAAGCTTCTAAACAGAAAG GTGTCAACTCTGCCCGCTCAGT

TCCTCCTTCCTACCCACCACCACAGGACCCGTTAAACCAGGGCCAGTACCTGGTCCCCGATGGCATCGCTCAGTCTCAAGTGTTTGAGTTCACTGAACCG

AAACGCAGCCAGTCACCATTCTGGCAAAACTTCAGTAGGTTAACCCCCTTCAAAAAATAATACCTATAGGAAGGCAGATAATTTTAAAATAAATAAAATT

ATATTTATAGATGGACCTTTTTTTCGGAGAAGCACTGTTGAAAATTTATATATATATATATATATAAAATGTGTGTGTGTGAGAGAGAGTGAGTGTGTGT

GTGTGCGTGTGTGTGCACACATACATGCACACACACACACGCACACATAGACCTTTACGTATACACGTGTGTGTGTGGGCATGTGTGCACATATGCATGC

ACATGCATGCACACATACATACATATACACACACAGAGAAGGACCAAAACCATTTTCTGTTGTTTTGGGGAGTTGAAATCTGTAGTTGGTAAGAAGTACC

ACTGATTTCCAAACATGTAATCACTTCTTCAAATTTTTAGTTCTTAACCTTGTTTCCTCCCCCTTACTCTCTGTTATTTTTCCTGTTAAGATAACTTATT

CGCTCCTCTAGTTCACTGACCTGTCATTATTACCATAGAGTATTTGCATTGTTTTATTTCCCTTTCCTTATGATACTGACGCTGATAACTTTTGAATTGA

ATTTATGTAGTGGGTTTGGGATTTCATTTCTCTCCCTGTCACTTTCCACTGAGAAGGGGAGGATTCCCGTCTCCTGTTCCTCATGCACCCATCTGCAAAT

GTTCCTGTAGCCCTGCAGTTATACCAACAGCCTCTTCCCAGCATCCTGTGTCCACAATTGTGCCAGTCTATACATGCTCTGTTGTGCCCTGTGACTTATC

TGCTTGGTATTTCTATTGCTTTCACTGTTTTAGGTATTGTGGAAGGATATAAAACCAAACAGAAACAAAGGAGTGAACGAATGTAATGAGAGTCGAGAAG

ATTTCTGTTAGGGGGATAGTTTTTATTTAGGTGATTTCTTCCCATATAACAGCAATGCTAAGCCATTGAAAGTTTCCACCTAAGAATTAGTTTGGGTCCA

TTAGTCTCTTTTCCAAGCCTCTTTTGTTATGGATCTCCTTTTCAGTCTATCTCTTCCCTAGGCAAAAGGTTTAACTAAACTAGTAGCAAAGAAATTGAGA

CTTTGCATCCTGGGGAAGAGATTTATCTCCACCCCATAACTCATAGATGGTAGGTAGGTGTCAGGCAGGGCTCTCTTTATAGTGTTCTGGTAACCCCTGC

TTCTGTTTTCAGATTCATAAGGCATCATTGTTAGTAGTTTATGGAGGCGTTCAAGAGAAAAACCTGCTTGGCCAAGAGCATTAGCCACCTTCAGATTAAC

CTGAAAAGAGTTCAAGGTTGACAACAGCATCTTATAGAGACCATCAGGAAAAGAGAGAGGCTTGATCTAAGATAATATACCAGTAATTTGCATCACTGAA

ATTATAAGAAACATCCCCAATTGTTAGCAGATTGCATGGATAATCTCTGTCTCCTTTTTTTGCCCTTACTGTCTTTCAGGTAGAGGATTGCGAGTATGGG

ATAGTTAGAGCCATTATGGCACTCAAAGCAGGCTTTGTTCCAGACAGACTCCCATCCCAGGACAACTGAGGCAAGTGGTAGAGAAGCCTAGGGCTACTTT

TACATCTGGGGGAAAAGAAAAGATCTGAGGTAGAACACTGAAGTTATTTCTTGGCAGGGTTTCCATTTGACCAGAATGTTTCCCACAAAAATCAGAATCC

TCATGAGTACAAGAGTGCTTATTCTTTGTCATTTAGCCCTTTCTATGGCTAGAGATTGGAGCAAGAACAATAGAATATAAAGAAGTGTGAAAACCCACCC

TATCCAGGAATCTGGAGATTGTGTCTGTCCTGGACCTCACAAGAAAATACTTCATTATAAAAAAAAAAGATCTAAGCTTACCAAGTAGCAACCATAGCTG

TATGAGGTCTTCAAAAAAGCTGAATTTGTACTTCTTGACCTAGATTAAGCCCTACCCCTGAGAATCTTTCCCCTCTGAAAAACAAATTACACATTGTTGT

CAGACTTTGTAGTTATCAAGGCTAACTAGCAGAATACCAGGGCTCGGGACTGGCTATCACTGCTCAGCATATGATAGAGCTACATAAGCCCTTATGGCAA

GAAATCTGGCATCGAGCACATAGACTACAATGCTCTCCCTTGGCAAACTGAAATGTGTTTCACTTCCTATGCAGGCCTCCCTTATTGCACCTTCATTTCC

TACTTTCTACCCATTCTCACTAGGCTTGGCCTTGGCAACTTTCTCCCAGGGTTAGGAGCACACCAGGAGGGCTTGTTTTGAAAGGTTTCTAGATCTATAG

TATCTTTTGGCCAGACCTTCTCATTCTTTTCCCCTTTCTGAGTCCAACATTCAAGGCTCCCAGATCAGGGGTATTACCTCTCATCATCCTGTTTCTCCAT

CCAGTCCACTAACCTTACAAGATGTAGTAATTTGTGAAGGCACTACCAACTCCGCTCTCCTTGGATTGGAATGCCTGGCTCCACCCTCACACCTACAGCT

CCAAATAGATCAGTGGCCAGTAGCCCAAAGGGAAACTCATCAATTCCCTGGACTCAGTAGCTGAACCTGCTGCAGCCCCACGGCCATATAATCCCCCCCA

AAAATAACTCTATACTTCTCCTGTTTCTGCATGGCCCCAGACTCCCCTTTCCTCAACTCAATGAGGCCCGAACTTTCTTTCTCCAGTTTTGTGAGTTTGT

TCTATGAGTTCTATTATAGGGAGGTCCTAAATACAGAAATACAATTTTTCTCTCCTTCTCTCATCCACTTTCTATGTGTATATCTTTAATTGATCTATTA

AGGACAGCAGCAAGAGAGTTCTAACAATTCTAGTATGAAGCCAAATAGTGCTATTTTAGTGCTTTGGGGGTGGGGCGGGCTGGGTGACTAGATGGGCAAC

AGTGATTTTGACCCCTGCTGCTCTGCATTTGCCGGCTTATTCTTTTGTTTCTATTATCCGACTGTTTGACCCTGTCAAACAAGTGTCAAAATTGTGTATT

TGGAAATGTTTAACAACAACAACAACAAAAAAGATGTTGTAATGACATAAAGCCTTATGAAAATATTTATGGAGTTCAATAAAAGAAGT
Translation
MTQ LITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVR LWVNQEDGVEEGPSDVQNGHLDPNSDCLCLGRPLQ

NRDQMRANVINEIMSTERHYIKHLKDICE GYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCFLEH QDGFWIYSE

YCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHS SDYRYVAAALAVMRNVTQQINERKRRLENI

DKIAQWQASVLDWE GEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKK DLIRRDILYYKGRIDMDKYEVIDIEDGRDDDFNVSMKNAF

KLHNKETEEVHLFFAKKLEEKIRWLRAFREERKMVQEDEKIG GFEISENQKRQAAMTVRKASKQKG GVNSARSVPPSYPPPQDPLNQGQYLVPDGIAQ

SQVFEFTEPKRSQSPFWQNFSRLTPFKK
Transcript ENSMUST00000113881
Sequence
ATGTTATATGACAG - UNI37830 - GCTGATCACTGGAGATTCCATCGTTAGTGCTGAGGCAGTATGGGATCACGTCACCATGGCCAACCGGGAGTT

GGCATTTAAGGCTGGCGACGTCATCAAAGTCTTGGATGCTTCCAACAAGGATTGGTGGTGGGGCCAGATCGACGATGAGGAGGGATGGTTTCCTGCCAGC

TTTGTGAGG CTCTGGGTGAACCAGGAGGATGGGGTGGAGGAAGGGCCCAGTGATGTGCAGAATGGGCACCTGGACCCCAACTCAGACTGCCTTTGTCTG

GGCCGGCCACTACAGAACCGGGACCAGATGCGGGCCAATGTCATCAATGAGATCATGAGCACGGAGCGCCATTACATCAAGCACCTCAAGGACATTTGCG

AG GGCTACCTGAAGCAGTGCCGAAAGAGAAGGGACATGTTCAGTGACGAGCAGCTGAAGGTCATCTTTGGAAACATTGAAGACATATACAGATTTCAGA

TGGGCTTCGTGAGAGACCTGGAGAAGCAGTACAACAATGATGATCCCCACCTCAGTGAGATAGGACCCTGCTTCTTAGAGCAT CAAGATGGATTCTGGA

TATACTCTGAATATTGTAACAACCACCTGGATGCCTGCATGGAACTCTCCAAGCTGATGAAGGACAGCCGCTATCAACACTTCTTTGAGGCCTGCCGCCT

CTTGCAGCAGATGATCGACATTGCTATTGATGGTTTTCTTTTGACTCCAGTACAGAAGATCTGCAAATATCCCTTACAATTGGCCGAGCTCCTAAAGTAT

ACTGCCCAAGATCACAG TGATTACAGATACGTTGCAGCTGCTTTGGCTGTCATGAGAAATGTGACTCAGCAGATCAATGAACGCAAGCGACGTCTGGAG

AATATTGACAAGATTGCGCAATGGCAGGCCTCTGTCCTAGACTGGGAG GGAGAGGACATCTTAGACAGGAGCTCGGAGCTGATCTACACTGGAGAGATG

GCCTGGATCTACCAGCCCTATGGCCGCAACCAGCAGAGAGTCTTCTTCCTGTTTGACCACCAGATGGTCCTCTGCAAGAAG GACCTAATCCGGAGAGAC

ATCCTATACTACAAGGGGCGCATTGACATGGATAAATATGAGGTAATTGACATCGAAGATGGCAGAGATGATGACTTTAATGTCAGCATGAAAAATGCTT

TCAAGCTTCATAACAAGGAAACGGAAGAAGTGCATCTGTTCTTTGCCAAGAAACTGGAGGAGAAAATACGTTGGCTTAGAGCTTTCAGAGAAGAGAGAAA

AATGGTACAAGAAGATGAAAAAATTG GCTTTGAGATTTCTGAAAATCAGAAGAGACAGGCTGCAATGACTGTGAGAAAAGCTTCTAAACAGAAAG GTG

TCAACTCTGCCCGCTCAGTTCCTCCTTCCTACCCACCACCACAGGACCCGTTAAACCAGGGCCAGTACCTGGTCCCCGATGGCATCGCTCAGTCTCAAGT

GTTTGAGTTCACTGAACCGAAACGCAGCCAGTCACCATTCTGGCAAAACTTCAGTAGGTTAACCCCCTTCAAAAAATAATACCTATAGGAAGGCAGATAA

TTTTAAAATAAATAAAATTATATTTATAGATGGACCTTTTTTTCGGAGAAGCACTGTTGAAAATTTATATATATATATATATATAAAATGTGTGTGTGTG

AGAGAGAGTGAGTGTGTGTGTGTGCGTGTGTGTGCACACATACATGCACACACACACACGCACACATAGACCTTTACGTATACACGTGTGTGTGTGGGCA

TGTGTGCACATATGCATGCACATGCATGCACACATACATACATATACACACACAGAGAAGGACCAAAACCATTTTCTGTTGTTTTGGGGAGTTGAAATCT

GTAGTTGGTAAGAAGTACCACTGATTTCCAAACATGTAATCACTTCTTCAAATTTTTAGTTCTTAACCTTGTTTCCTCCCCCTTACTCTCTGTTATTTTT

CCTGTTAAGATAACTTATTCGCTCCTCTAGTTCACTGACCTGTCATTATTACCATAGAGTATTTGCATTGTTTTATTTCCCTTTCCTTATGATACTGACG

CTGATAACTTTTGAATTGAATTTATGTAGTGGGTTTGGGATTTCATTTCTCTCCCTGTCACTTTCCACTGAGAAGGGGAGGATTCCCGTCTCCTGTTCCT

CATGCACCCATCTGCAAATGTTCCTGTAGCCCTGCAGTTATACCAACAGCCTCTTCCCAGCATCCTGTGTCCACAATTGTGCCAGTCTATACATGCTCTG

TTGTGCCCTGTGACTTATCTGCTTGGTATTTCTATTGCTTTCACTGTTTTAGGTATTGTGGAAGGATATAAAACCAAACAGAAACAAAGGAGTGAACGAA

TGTAATGAGAGTCGAGAAGATTTCTGTTAGGGGGATAGTTTTTATTTAGGTGATTTCTTCCCATATAACAGCAATGCTAAGCCATTGAAAGTTTCCACCT

AAGAATTAGTTTGGGTCCATTAGTCTCTTTTCCAAGCCTCTTTTGTTATGGATCTCCTTTTCAGTCTATCTCTTCCCTAGGCAAAAGGTTTAACTAAACT

AGTAGCAAAGAAATTGAGACTTTGCATCCTGGGGAAGAGATTTATCTCCACCCCATAACTCATAGATGGTAGGTAGGTGTCAGGCAGGGCTCTCTTTATA

GTGTTCTGGTAACCCCTGCTTCTGTTTTCAGATTCATAAGGCATCATTGTTAGTAGTTTATGGAGGCGTTCAAGAGAAAAACCTGCTTGGCCAAGAGCAT

TAGCCACCTTCAGATTAACCTGAAAAGAGTTCAAGGTTGACAACAGCATCTTATAGAGACCATCAGGAAAAGAGAGAGGCTTGATCTAAGATAATATACC

AGTAATTTGCATCACTGAAATTATAAGAAACATCCCCAATTGTTAGCAGATTGCATGGATAATCTCTGTCTCCTTTTTTTGCCCTTACTGTCTTTCAGGT

AGAGGATTGCGAGTATGGGATAGTTAGAGCCATTATGGCACTCAAAGCAGGCTTTGTTCCAGACAGACTCCCATCCCAGGACAACTGAGGCAAGTGGTAG

AGAAGCCTAGGGCTACTTTTACATCTGGGGGAAAAGAAAAGATCTGAGGTAGAACACTGAAGTTATTTCTTGGCAGGGTTTCCATTTGACCAGAATGTTT

CCCACAAAAATCAGAATCCTCATGAGTACAAGAGTGCTTATTCTTTGTCATTTAGCCCTTTCTATGGCTAGAGATTGGAGCAAGAACAATAGAATATAAA

GAAGTGTGAAAACCCACCCTATCCAGGAATCTGGAGATTGTGTCTGTCCTGGACCTCACAAGAAAATACTTCATTATAAAAAAAAAAGATCTAAGCTTAC

CAAGTAGCAACCATAGCTGTATGAGGTCTTCAAAAAAGCTGAATTTGTACTTCTTGACCTAGATTAAGCCCTACCCCTGAGAATCTTTCCCCTCTGAAAA

ACAAATTACACATTGTTGTCAGACTTTGTAGTTATCAAGGCTAACTAGCAGAATACCAGGGCTCGGGACTGGCTATCACTGCTCAGCATATGATAGAGCT

ACATAAGCCCTTATGGCAAGAAATCTGGCATCGAGCACATAGACTACAATGCTCTCCCTTGGCAAACTGAAATGTGTTTCACTTCCTATGCAGGCCTCCC

TTATTGCACCTTCATTTCCTACTTTCTACCCATTCTCACTAGGCTTGGCCTTGGCAACTTTCTCCCAGGGTTAGGAGCACACCAGGAGGGCTTGTTTTGA

AAGGTTTCTAGATCTATAGTATCTTTTGGCCAGACCTTCTCATTCTTTTCCCCTTTCTGAGTCCAACATTCAAGGCTCCCAGATCAGGGGTATTACCTCT

CATCATCCTGTTTCTCCATCCAGTCCACTAACCTTACAAGATGTAGTAATTTGTGAAGGCACTACCAACTCCGCTCTCCTTGGATTGGAATGCCTGGCTC

CACCCTCACACCTACAGCTCCAAATAGATCAGTGGCCAGTAGCCCAAAGGGAAACTCATCAATTCCCTGGACTCAGTAGCTGAACCTGCTGCAGCCCCAC

GGCCATATAATCCCCCCCAAAAATAACTCTATACTTCTCCTGTTTCTGCATGGCCCCAGACTCCCCTTTCCTCAACTCAATGAGGCCCGAACTTTCTTTC

TCCAGTTTTGTGAGTTTGTTCTATGAGTTCTATTATAGGGAGGTCCTAAATACAGAAATACAATTTTTCTCTCCTTCTCTCATCCACTTTCTATGTGTAT

ATCTTTAATTGATCTATTAAGGACAGCAGCAAGAGAGTTCTAACAATTCTAGTATGAAGCCAAATAGTGCTATTTTAGTGCTTTGGGGGTGGGGCGGGCT

GGGTGACTAGATGGGCAACAGTGATTTTGACCCCTGCTGCTCTGCATTTGCCGGCTTATTCTTTTGTTTCTATTATCCGACTGTTTGACCCTGTCAAACA

AGTGTCAAAATTGTGTATTTGGAAATGTTTAACAACAACAACAACAAAAAAGATGTTGTAATGACATAAAGCCTTATGAAAATATTTATGGAGTTCAATA

AAAGAAGT
Translation
MLYDR - UNI37830 - RLITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVR LWVNQEDGVEEGPSDVQNG

HLDPNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIKHLKDICE GYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIG

PCFLEH QDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHS SDYRYVAAALAVMR

NVTQQINERKRRLENIDKIAQWQASVLDWE GEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKK DLIRRDILYYKGRIDMDKYEVIDI

EDGRDDDFNVSMKNAFKLHNKETEEVHLFFAKKLEEKIRWLRAFREERKMVQEDEKIG GFEISENQKRQAAMTVRKASKQKG GVNSARSVPPSYPPPQ

DPLNQGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
Transcript ENSMUST00000113882
Sequence
GTCAGAGACTCACGCTGGCGCCCCCAGTTTCTGCGTGAATAAAAAGGCAACCTACCGGCTGAG - UNI37830 - CATGGTGGCTGTATGGACAGTCT

GACAGAACAGAGATTGACATCTCCCAATCTGCCGGCCCCCCACCTGGAACACTACAGTGTTCTGCATTGCACCATGACCCTGGATGTGCAAACTGTAGTC

GTTTTTGCCGTGATTGTAGTCCTCCTGCTTGTCAATGTCATACTCATGTTTTTCTTGGGAACGCGCTGAATGGAGTCCAGCCACCTGAGCTGTTGCGAAC

TCTCACTTTGATTTCATCCCAAGAGCCTCTGAGGGGGAAAAAATCAGGAGAGACAGTCTGAGACAGGGAAAGAGAGGGAGAAAAAGAACAAGCTTTCTTA

CTCAGGGGGGAAAACGTTTTGAGCTTCAACATGGCCTCGCTGTGATATGTATGACGTTG - UNI37830 - CTGATCACTGGAGATTCCATCGTTAGT

GCTGAGGCAGTATGGGATCACGTCACCATGGCCAACCGGGAGTTGGCATTTAAGGCTGGCGACGTCATCAAAGTCTTGGATGCTTCCAACAAGGATTGGT

GGTGGGGCCAGATCGACGATGAGGAGGGATGGTTTCCTGCCAGCTTTGTGAGG CTCTGGGTGAACCAGGAGGATGGGGTGGAGGAAGGGCCCAGTGATG

TGCAGAATGGGCACCTGGACCCCAACTCAGACTGCCTTTGTCTGGGCCGGCCACTACAGAACCGGGACCAGATGCGGGCCAATGTCATCAATGAGATCAT

GAGCACGGAGCGCCATTACATCAAGCACCTCAAGGACATTTGCGAG GGCTACCTGAAGCAGTGCCGAAAGAGAAGGGACATGTTCAGTGACGAGCAGCT

GAAGGTCATCTTTGGAAACATTGAAGACATATACAGATTTCAGATGGGCTTCGTGAGAGACCTGGAGAAGCAGTACAACAATGATGATCCCCACCTCAGT

GAGATAGGACCCTGCTTCTTAGAGCAT CAAGATGGATTCTGGATATACTCTGAATATTGTAACAACCACCTGGATGCCTGCATGGAACTCTCCAAGCTG

ATGAAGGACAGCCGCTATCAACACTTCTTTGAGGCCTGCCGCCTCTTGCAGCAGATGATCGACATTGCTATTGATGGTTTTCTTTTGACTCCAGTACAGA

AGATCTGCAAATATCCCTTACAATTGGCCGAGCTCCTAAAGTATACTGCCCAAGATCACAG TGATTACAGATACGTTGCAGCTGCTTTGGCTGTCATGA

GAAATGTGACTCAGCAGATCAATGAACGCAAGCGACGTCTGGAGAATATTGACAAGATTGCGCAATGGCAGGCCTCTGTCCTAGACTGGGAG GGAGAGG

ACATCTTAGACAGGAGCTCGGAGCTGATCTACACTGGAGAGATGGCCTGGATCTACCAGCCCTATGGCCGCAACCAGCAGAGAGTCTTCTTCCTGTTTGA

CCACCAGATGGTCCTCTGCAAGAAG GACCTAATCCGGAGAGACATCCTATACTACAAGGGGCGCATTGACATGGATAAATATGAGGTAATTGACATCGA

AGATGGCAGAGATGATGACTTTAATGTCAGCATGAAAAATGCTTTCAAGCTTCATAACAAGGAAACGGAAGAAGTGCATCTGTTCTTTGCCAAGAAACTG

GAGGAGAAAATACGTTGGCTTAGAGCTTTCAGAGAAGAGAGAAAAATGGTACAAGAAGATGAAAAAATTG GCTTTGAGATTTCTGAAAATCAGAAGAGA

CAGGCTGCAATGACTGTGAGAAAAGCTTCTAAACAGAAAG GTGTCAACTCTGCCCGCTCAGTTCCTCCTTCCTACCCACCACCACAGGACCCGTTAAAC

CAGGGCCAGTACCTGGTCCCCGATGGCATCGCTCAGTCTCAAGTGTTTGAGTTCACTGAACCGAAACGCAGCCAGTCACCATTCTGGCAAAACTTCAGTA

GGTTAACCCCCTTCAAAAAATAATACCTATAGGAAGGCAGATAATTTTAAAATAAATAAAATTATATTTATAGATGGACCTTTTTTTCGGAGAAGCACTG

TTGAAAATTTATATATATATATATATATAAAATGTGTGTGTGTGAGAGAGAGTGAGTGTGTGTGTGTGCGTGTGTGTGCACACATACATGCACACACACA

CACGCACACATAGACCTTTACGTATACACGTGTGTGTGTGGGCATGTGTGCACATATGCATGCACATGCATGCACACATACATACATATACACACACAGA

GAAGGACCAAAACCATTTTCTGTTGTTTTGGGGAGTTGAAATCTGTAGTTGGTAAGAAGTACCACTGATTTCCAAACATGTAATCACTTCTTCAAATTTT

TAGTTCTTAACCTTGTTTCCTCCCCCTTACTCTCTGTTATTTTTCCTGTTAAGATAACTTATTCGCTCCTCTAGTTCACTGACCTGTCATTATTACCATA

GAGTATTTGCATTGTTTTATTTCCCTTTCCTTATGATACTGACGCTGATAACTTTTGAATTGAATTTATGTAGTGGGTTTGGGATTTCATTTCTCTCCCT

GTCACTTTCCACTGAGAAGGGGAGGATTCCCGTCTCCTGTTCCTCATGCACCCATCTGCAAATGTTCCTGTAGCCCTGCAGTTATACCAACAGCCTCTTC

CCAGCATCCTGTGTCCACAATTGTGCCAGTCTATACATGCTCTGTTGTGCCCTGTGACTTATCTGCTTGGTATTTCTATTGCTTTCACTGTTTTAGGTAT

TGTGGAAGGATATAAAACCAAACAGAAACAAAGGAGTGAACGAATGTAATGAGAGTCGAGAAGATTTCTGTTAGGGGGATAGTTTTTATTTAGGTGATTT

CTTCCCATATAACAGCAATGCTAAGCCATTGAAAGTTTCCACCTAAGAATTAGTTTGGGTCCATTAGTCTCTTTTCCAAGCCTCTTTTGTTATGGATCTC

CTTTTCAGTCTATCTCTTCCCTAGGCAAAAGGTTTAACTAAACTAGTAGCAAAGAAATTGAGACTTTGCATCCTGGGGAAGAGATTTATCTCCACCCCAT

AACTCATAGATGGTAGGTAGGTGTCAGGCAGGGCTCTCTTTATAGTGTTCTGGTAACCCCTGCTTCTGTTTTCAGATTCATAAGGCATCATTGTTAGTAG

TTTATGGAGGCGTTCAAGAGAAAAACCTGCTTGGCCAAGAGCATTAGCCACCTTCAGATTAACCTGAAAAGAGTTCAAGGTTGACAACAGCATCTTATAG

AGACCATCAGGAAAAGAGAGAGGCTTGATCTAAGATAATATACCAGTAATTTGCATCACTGAAATTATAAGAAACATCCCCAATTGTTAGCAGATTGCAT

GGATAATCTCTGTCTCCTTTTTTTGCCCTTACTGTCTTTCAGGTAGAGGATTGCGAGTATGGGATAGTTAGAGCCATTATGGCACTCAAAGCAGGCTTTG

TTCCAGACAGACTCCCATCCCAGGACAACTGAGGCAAGTGGTAGAGAAGCCTAGGGCTACTTTTACATCTGGGGGAAAAGAAAAGATCTGAGGTAGAACA

CTGAAGTTATTTCTTGGCAGGGTTTCCATTTGACCAGAATGTTTCCCACAAAAATCAGAATCCTCATGAGTACAAGAGTGCTTATTCTTTGTCATTTAGC

CCTTTCTATGGCTAGAGATTGGAGCAAGAACAATAGAATATAAAGAAGTGTGAAAACCCACCCTATCCAGGAATCTGGAGATTGTGTCTGTCCTGGACCT

CACAAGAAAATACTTCATTATAAAAAAAAAAGATCTAAGCTTACCAAGTAGCAACCATAGCTGTATGAGGTCTTCAAAAAAGCTGAATTTGTACTTCTTG

ACCTAGATTAAGCCCTACCCCTGAGAATCTTTCCCCTCTGAAAAACAAATTACACATTGTTGTCAGACTTTGTAGTTATCAAGGCTAACTAGCAGAATAC

CAGGGCTCGGGACTGGCTATCACTGCTCAGCATATGATAGAGCTACATAAGCCCTTATGGCAAGAAATCTGGCATCGAGCACATAGACTACAATGCTCTC

CCTTGGCAAACTGAAATGTGTTTCACTTCCTATGCAGGCCTCCCTTATTGCACCTTCATTTCCTACTTTCTACCCATTCTCACTAGGCTTGGCCTTGGCA

ACTTTCTCCCAGGGTTAGGAGCACACCAGGAGGGCTTGTTTTGAAAGGTTTCTAGATCTATAGTATCTTTTGGCCAGACCTTCTCATTCTTTTCCCCTTT

CTGAGTCCAACATTCAAGGCTCCCAGATCAGGGGTATTACCTCTCATCATCCTGTTTCTCCATCCAGTCCACTAACCTTACAAGATGTAGTAATTTGTGA

AGGCACTACCAACTCCGCTCTCCTTGGATTGGAATGCCTGGCTCCACCCTCACACCTACAGCTCCAAATAGATCAGTGGCCAGTAGCCCAAAGGGAAACT

CATCAATTCCCTGGACTCAGTAGCTGAACCTGCTGCAGCCCCACGGCCATATAATCCCCCCCAAAAATAACTCTATACTTCTCCTGTTTCTGCATGGCCC

CAGACTCCCCTTTCCTCAACTCAATGAGGCCCGAACTTTCTTTCTCCAGTTTTGTGAGTTTGTTCTATGAGTTCTATTATAGGGAGGTCCTAAATACAGA

AATACAATTTTTCTCTCCTTCTCTCATCCACTTTCTATGTGTATATCTTTAATTGATCTATTAAGGACAGCAGCAAGAGAGTTCTAACAATTCTAGTATG

AAGCCAAATAGTGCTATTTTAGTGCTTTGGGGGTGGGGCGGGCTGGGTGACTAGATGGGCAACAGTGATTTTGACCCCTGCTGCTCTGCATTTGCCGGCT

TATTCTTTTGTTTCTATTATCCGACTGTTTGACCCTGTCAAACAAGTGTCAAAATTGTGTATTTGGAAATGTTTAACAACAACAACAACAAAAAAGATGT

TGTAATGACATAAAGCCTTATGAAAATATTTATGGAGTTCAATAAAAGAAGT
Translation
 - UNI37830 - MTL - UNI37830 - LITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVR LWVNQEDG

VEEGPSDVQNGHLDPNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIKHLKDICE GYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQY

NNDDPHLSEIGPCFLEH QDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHS SDY

RYVAAALAVMRNVTQQINERKRRLENIDKIAQWQASVLDWE GEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKK DLIRRDILYYKGR

IDMDKYEVIDIEDGRDDDFNVSMKNAFKLHNKETEEVHLFFAKKLEEKIRWLRAFREERKMVQEDEKIG GFEISENQKRQAAMTVRKASKQKG GVNSA

RSVPPSYPPPQDPLNQGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
Transcript ENSMUST00000113883
Sequence
AGAGGGAGAGGGCAAGCTAGGAAAGGCTAGGAAGAGTGGCTGGTAGCCTGGAATCCCTTGAAGAGAGCTAGCAGACGAGAGAGATCTTAGGAAGCTGATG

AACTAGAAAGAGTAGGGGAGACTGAGACTGACCGGTAGCCAGCTAGGCAGACAGACGCATGCCCGGACAGACTCTGGAGAACCGATAGGTTCATTTTGCC

TTTCTTTTTGAAAAGCAGGATTTTGATTTTTCTGTGGCGCCCAAGAGAGAATGCTGGACTCTGCTACCTTCAGCTTAAGCTAAGATTTCTCAGTTAGGGA

GGAAAGATCAGCCCAGTCCCGAGAGGGGGAGGGAAGCAAAAGCCCCTGCCTCCAACCCCCTTCCCTCCCCCGGACCAAACTCGGGGACCAAACCCAGACC

TTCCCTAACCATCTGACTTCCTCCTTTCCTTTTTAGCATGGTGGCTGTATGGACAGTCTGACAGAACAGAGATTGACATCTCCCAATCTGCCGGCCCCCC

ACCTGGAACACTACAGTGTTCTGCATTGCACCATGACCCTGGATGTGCAAACTGTAGTCGTTTTTGCCGTGATTGTAGTCCTCCTGCTTGTCAATGTCAT

ACTCATGTTTTTCTTGGGAACGCGCTGAATGGAGTCCAGCCACCTGAGCTGTTGCGAACTCTCACTTTGATTTCATCCCAAGAGCCTCTGAGGGGGAAAA

AATCAGGAGAGACAGTCTGAGACAGGGAAAGAGAGGGAGAAAAAGAACAAGCTTTCTTACTCAGGGGGGAAAACGTTTTGAGCTTCAACATGGCCTCGCT

GTGATATGTATGACGTTG - UNI37830 - CTGATCACTGGAGATTCCATCGTTAGTGCTGAGGCAGTATGGGATCACGTCACCATGGCCAACCGGGA

GTTGGCATTTAAGGCTGGCGACGTCATCAAAGTCTTGGATGCTTCCAACAAGGATTGGTGGTGGGGCCAGATCGACGATGAGGAGGGATGGTTTCCTGCC

AGCTTTGTGAGG CTCTGGGTGAACCAGGAGGATGGGGTGGAGGAAGGGCCCAGTGATGTGCAGAATGGGCACCTGGACCCCAACTCAGACTGCCTTTGT

CTGGGCCGGCCACTACAGAACCGGGACCAGATGCGGGCCAATGTCATCAATGAGATCATGAGCACGGAGCGCCATTACATCAAGCACCTCAAGGACATTT

GCGAG GGCTACCTGAAGCAGTGCCGAAAGAGAAGGGACATGTTCAGTGACGAGCAGCTGAAGGTCATCTTTGGAAACATTGAAGACATATACAGATTTC

AGATGGGCTTCGTGAGAGACCTGGAGAAGCAGTACAACAATGATGATCCCCACCTCAGTGAGATAGGACCCTGCTTCTTAGAGCAT CAAGATGGATTCT

GGATATACTCTGAATATTGTAACAACCACCTGGATGCCTGCATGGAACTCTCCAAGCTGATGAAGGACAGCCGCTATCAACACTTCTTTGAGGCCTGCCG

CCTCTTGCAGCAGATGATCGACATTGCTATTGATGGTTTTCTTTTGACTCCAGTACAGAAGATCTGCAAATATCCCTTACAATTGGCCGAGCTCCTAAAG

TATACTGCCCAAGATCACAG TGATTACAGATACGTTGCAGCTGCTTTGGCTGTCATGAGAAATGTGACTCAGCAGATCAATGAACGCAAGCGACGTCTG

GAGAATATTGACAAGATTGCGCAATGGCAGGCCTCTGTCCTAGACTGGGAG GGAGAGGACATCTTAGACAGGAGCTCGGAGCTGATCTACACTGGAGAG

ATGGCCTGGATCTACCAGCCCTATGGCCGCAACCAGCAGAGAGTCTTCTTCCTGTTTGACCACCAGATGGTCCTCTGCAAGAAG GACCTAATCCGGAGA

GACATCCTATACTACAAGGGGCGCATTGACATGGATAAATATGAGGTAATTGACATCGAAGATGGCAGAGATGATGACTTTAATGTCAGCATGAAAAATG

CTTTCAAGCTTCATAACAAGGAAACGGAAGAAGTGCATCTGTTCTTTGCCAAGAAACTGGAGGAGAAAATACGTTGGCTTAGAGCTTTCAGAGAAGAGAG

AAAAATGGTACAAGAAGATGAAAAAATTG GCTTTGAGATTTCTGAAAATCAGAAGAGACAGGCTGCAATGACTGTGAGAAAAGCTTCTAAACAGAAAG 

GTGTCAACTCTGCCCGCTCAGTTCCTCCTTCCTACCCACCACCACAGGACCCGTTAAACCAGGGCCAGTACCTGGTCCCCGATGGCATCGCTCAGTCTCA

AGTGTTTGAGTTCACTGAACCGAAACGCAGCCAGTCACCATTCTGGCAAAACTTCAGTAGGTTAACCCCCTTCAAAAAATAATACCTATAGGAAGGCAGA

TAATTTTAAAATAAATAAAATTATATTTATAGATGGACCTTTTTTTCGGAGAAGCACTGTTGAAAATTTATATATATATATATATATAAAATGTGTGTGT

GTGAGAGAGAGTGAGTGTGTGTGTGTGCGTGTGTGTGCACACATACATGCACACACACACACGCACACATAGACCTTTACGTATACACGTGTGTGTGTGG

GCATGTGTGCACATATGCATGCACATGCATGCACACATACATACATATACACACACAGAGAAGGACCAAAACCATTTTCTGTTGTTTTGGGGAGTTGAAA

TCTGTAGTTGGTAAGAAGTACCACTGATTTCCAAACATGTAATCACTTCTTCAAATTTTTAGTTCTTAACCTTGTTTCCTCCCCCTTACTCTCTGTTATT

TTTCCTGTTAAGATAACTTATTCGCTCCTCTAGTTCACTGACCTGTCATTATTACCATAGAGTATTTGCATTGTTTTATTTCCCTTTCCTTATGATACTG

ACGCTGATAACTTTTGAATTGAATTTATGTAGTGGGTTTGGGATTTCATTTCTCTCCCTGTCACTTTCCACTGAGAAGGGGAGGATTCCCGTCTCCTGTT

CCTCATGCACCCATCTGCAAATGTTCCTGTAGCCCTGCAGTTATACCAACAGCCTCTTCCCAGCATCCTGTGTCCACAATTGTGCCAGTCTATACATGCT

CTGTTGTGCCCTGTGACTTATCTGCTTGGTATTTCTATTGCTTTCACTGTTTTAGGTATTGTGGAAGGATATAAAACCAAACAGAAACAAAGGAGTGAAC

GAATGTAATGAGAGTCGAGAAGATTTCTGTTAGGGGGATAGTTTTTATTTAGGTGATTTCTTCCCATATAACAGCAATGCTAAGCCATTGAAAGTTTCCA

CCTAAGAATTAGTTTGGGTCCATTAGTCTCTTTTCCAAGCCTCTTTTGTTATGGATCTCCTTTTCAGTCTATCTCTTCCCTAGGCAAAAGGTTTAACTAA

ACTAGTAGCAAAGAAATTGAGACTTTGCATCCTGGGGAAGAGATTTATCTCCACCCCATAACTCATAGATGGTAGGTAGGTGTCAGGCAGGGCTCTCTTT

ATAGTGTTCTGGTAACCCCTGCTTCTGTTTTCAGATTCATAAGGCATCATTGTTAGTAGTTTATGGAGGCGTTCAAGAGAAAAACCTGCTTGGCCAAGAG

CATTAGCCACCTTCAGATTAACCTGAAAAGAGTTCAAGGTTGACAACAGCATCTTATAGAGACCATCAGGAAAAGAGAGAGGCTTGATCTAAGATAATAT

ACCAGTAATTTGCATCACTGAAATTATAAGAAACATCCCCAATTGTTAGCAGATTGCATGGATAATCTCTGTCTCCTTTTTTTGCCCTTACTGTCTTTCA

GGTAGAGGATTGCGAGTATGGGATAGTTAGAGCCATTATGGCACTCAAAGCAGGCTTTGTTCCAGACAGACTCCCATCCCAGGACAACTGAGGCAAGTGG

TAGAGAAGCCTAGGGCTACTTTTACATCTGGGGGAAAAGAAAAGATCTGAGGTAGAACACTGAAGTTATTTCTTGGCAGGGTTTCCATTTGACCAGAATG

TTTCCCACAAAAATCAGAATCCTCATGAGTACAAGAGTGCTTATTCTTTGTCATTTAGCCCTTTCTATGGCTAGAGATTGGAGCAAGAACAATAGAATAT

AAAGAAGTGTGAAAACCCACCCTATCCAGGAATCTGGAGATTGTGTCTGTCCTGGACCTCACAAGAAAATACTTCATTATAAAAAAAAAAGATCTAAGCT

TACCAAGTAGCAACCATAGCTGTATGAGGTCTTCAAAAAAGCTGAATTTGTACTTCTTGACCTAGATTAAGCCCTACCCCTGAGAATCTTTCCCCTCTGA

AAAACAAATTACACATTGTTGTCAGACTTTGTAGTTATCAAGGCTAACTAGCAGAATACCAGGGCTCGGGACTGGCTATCACTGCTCAGCATATGATAGA

GCTACATAAGCCCTTATGGCAAGAAATCTGGCATCGAGCACATAGACTACAATGCTCTCCCTTGGCAAACTGAAATGTGTTTCACTTCCTATGCAGGCCT

CCCTTATTGCACCTTCATTTCCTACTTTCTACCCATTCTCACTAGGCTTGGCCTTGGCAACTTTCTCCCAGGGTTAGGAGCACACCAGGAGGGCTTGTTT

TGAAAGGTTTCTAGATCTATAGTATCTTTTGGCCAGACCTTCTCATTCTTTTCCCCTTTCTGAGTCCAACATTCAAGGCTCCCAGATCAGGGGTATTACC

TCTCATCATCCTGTTTCTCCATCCAGTCCACTAACCTTACAAGATGTAGTAATTTGTGAAGGCACTACCAACTCCGCTCTCCTTGGATTGGAATGCCTGG

CTCCACCCTCACACCTACAGCTCCAAATAGATCAGTGGCCAGTAGCCCAAAGGGAAACTCATCAATTCCCTGGACTCAGTAGCTGAACCTGCTGCAGCCC

CACGGCCATATAATCCCCCCCAAAAATAACTCTATACTTCTCCTGTTTCTGCATGGCCCCAGACTCCCCTTTCCTCAACTCAATGAGGCCCGAACTTTCT

TTCTCCAGTTTTGTGAGTTTGTTCTATGAGTTCTATTATAGGGAGGTCCTAAATACAGAAATACAATTTTTCTCTCCTTCTCTCATCCACTTTCTATGTG

TATATCTTTAATTGATCTATTAAGGACAGCAGCAAGAGAGTTCTAACAATTCTAGTATGAAGCCAAATAGTGCTATTTTAGTGCTTTGGGGGTGGGGCGG

GCTGGGTGACTAGATGGGCAACAGTGATTTTGACCCCTGCTGCTCTGCATTTGCCGGCTTATTCTTTTGTTTCTATTATCCGACTGTTTGACCCTGTCAA

ACAAGTGTCAAAATTGTGTATTTGGAAATGTTTAACAACAACAACAACAAAAAAGATGTTGTAATGACATAAAGCCTTATGAAAATATTTATGGAGTTCA

ATAAAAGAAGTAAAAA
Translation
MTL - UNI37830 - LITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVR LWVNQEDGVEEGPSDVQNGHLD

PNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIKHLKDICE GYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCF

LEH QDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHS SDYRYVAAALAVMRNVT

QQINERKRRLENIDKIAQWQASVLDWE GEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKK DLIRRDILYYKGRIDMDKYEVIDIEDG

RDDDFNVSMKNAFKLHNKETEEVHLFFAKKLEEKIRWLRAFREERKMVQEDEKIG GFEISENQKRQAAMTVRKASKQKG GVNSARSVPPSYPPPQDPL

NQGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
Transcript ENSMUST00000113884
Sequence
GGCAGGCAGGGGTGGCAGCTGCCTTACCCTTGGCAGAGGTTATTTCCCCTATATTCTCGCCTGCATCCAACCCCTCAATTTGCACGCCTTGGAGGAAGAC

AAAGGCAGCTCCCTGGGACCCCCTCCCCCAGTTGCGTGTTTCCTTCCTGTCAAGCCCCCTGGGAAGCTGCAGGGTGGAGAAGCATAGCCCGCACGCCGGC

AAGAAACAACCAAACTGAAGGCTAGGTCAGGCTGAGGGGATTCGGCTGTAGCGCTGTGGAGGAGGGGAGGCGGAGTGGGCGCTGGGACTCTCGCTTCCTC

CAGCCCAGCCCTCCCTCCCAGTCAGCCCGCGACAACCCGCACCAGCCACCCGGCCTCACAGAAGCTGGACTTCGTGGACACCATGCAGTGGATTAGAGGC

GGAACGGGAATG - UNI37830 - CTGATCACTGGAGATTCCATCGTTAGTGCTGAGGCAGTATGGGATCACGTCACCATGGCCAACCGGGAGTTGGC

ATTTAAGGCTGGCGACGTCATCAAAGTCTTGGATGCTTCCAACAAGGATTGGTGGTGGGGCCAGATCGACGATGAGGAGGGATGGTTTCCTGCCAGCTTT

GTGAGG CTCTGGGTGAACCAGGAGGATGGGGTGGAGGAAGGGCCCAGTGATGTGCAGAATGGGCACCTGGACCCCAACTCAGACTGCCTTTGTCTGGGC

CGGCCACTACAGAACCGGGACCAGATGCGGGCCAATGTCATCAATGAGATCATGAGCACGGAGCGCCATTACATCAAGCACCTCAAGGACATTTGCGAG 

GGCTACCTGAAGCAGTGCCGAAAGAGAAGGGACATGTTCAGTGACGAGCAGCTGAAGGTCATCTTTGGAAACATTGAAGACATATACAGATTTCAGATGG

GCTTCGTGAGAGACCTGGAGAAGCAGTACAACAATGATGATCCCCACCTCAGTGAGATAGGACCCTGCTTCTTAGAGCAT CAAGATGGATTCTGGATAT

ACTCTGAATATTGTAACAACCACCTGGATGCCTGCATGGAACTCTCCAAGCTGATGAAGGACAGCCGCTATCAACACTTCTTTGAGGCCTGCCGCCTCTT

GCAGCAGATGATCGACATTGCTATTGATGGTTTTCTTTTGACTCCAGTACAGAAGATCTGCAAATATCCCTTACAATTGGCCGAGCTCCTAAAGTATACT

GCCCAAGATCACAG TGATTACAGATACGTTGCAGCTGCTTTGGCTGTCATGAGAAATGTGACTCAGCAGATCAATGAACGCAAGCGACGTCTGGAGAAT

ATTGACAAGATTGCGCAATGGCAGGCCTCTGTCCTAGACTGGGAG GGAGAGGACATCTTAGACAGGAGCTCGGAGCTGATCTACACTGGAGAGATGGCC

TGGATCTACCAGCCCTATGGCCGCAACCAGCAGAGAGTCTTCTTCCTGTTTGACCACCAGATGGTCCTCTGCAAGAAG GACCTAATCCGGAGAGACATC

CTATACTACAAGGGGCGCATTGACATGGATAAATATGAGGTAATTGACATCGAAGATGGCAGAGATGATGACTTTAATGTCAGCATGAAAAATGCTTTCA

AGCTTCATAACAAGGAAACGGAAGAAGTGCATCTGTTCTTTGCCAAGAAACTGGAGGAGAAAATACGTTGGCTTAGAGCTTTCAGAGAAGAGAGAAAAAT

GGTACAAGAAGATGAAAAAATTG GCTTTGAGATTTCTGAAAATCAGAAGAGACAGGCTGCAATGACTGTGAGAAAAGCTTCTAAACAGAAAG GTAGGG

TTGGAGAGGAAAAGAACCACAGTCTAAAACTGAAAAGAGTTTGTGAGGTTCTTCAGGGATATTATGGTCTCCTGAAAAGAAATCCTAACCAGGAACTCAG

CACAT GTGTCAACTCTGCCCGCTCAGTTCCTCCTTCCTACCCACCACCACAGGACCCGTTAAACCAGGGCCAGTACCTGGTCCCCGATGGCATCGCTCA

GTCTCAAGTGTTTGAGTTCACTGAACCGAAACGCAGCCAGTCACCATTCTGGCAAAACTTCAGTAGGTTAACCCCCTTCAAAAAATAATACCTATAGGAA

GGCAGATAATTTTAAAATAAATAAAATTATATTTATAGATGGACCTTTTTTTCGGAGAAGCACTGTTGAAAATTTATATATATATATATATATAAAATGT

GTGTGTGTGAGAGAGAGTGAGTGTGTGTGTGTGCGTGTGTGTGCACACATACATGCACACACACACACGCACACATAGACCTTTACGTATACACGTGTGT

GTGTGGGCATGTGTGCACATATGCATGCACATGCATGCACACATACATACATATACACACACAGAGAAGGACCAAAACCATTTTCTGTTGTTTTGGGGAG

TTGAAATCTGTAGTTGGTAAGAAGTACCACTGATTTCCAAACATGTAATCACTTCTTCAAATTTTTAGTTCTTAACCTTGTTTCCTCCCCCTTACTCTCT

GTTATTTTTCCTGTTAAGATAACTTATTCGCTCCTCTAGTTCACTGACCTGTCATTATTACCATAGAGTATTTGCATTGTTTTATTTCCCTTTCCTTATG

ATACTGACGCTGATAACTTTTGAATTGAATTTATGTAGTGGGTTTGGGATTTCATTTCTCTCCCTGTCACTTTCCACTGAGAAGGGGAGGATTCCCGTCT

CCTGTTCCTCATGCACCCATCTGCAAATGTTCCTGTAGCCCTGCAGTTATACCAACAGCCTCTTCCCAGCATCCTGTGTCCACAATTGTGCCAGTCTATA

CATGCTCTGTTGTGCCCTGTGACTTATCTGCTTGGTATTTCTATTGCTTTCACTGTTTTAGGTATTGTGGAAGGATATAAAACCAAACAGAAACAAAGGA

GTGAACGAATGTAATGAGAGTCGAGAAGATTTCTGTTAGGGGGATAGTTTTTATTTAGGTGATTTCTTCCCATATAACAGCAATGCTAAGCCATTGAAAG

TTTCCACCTAAGAATTAGTTTGGGTCCATTAGTCTCTTTTCCAAGCCTCTTTTGTTATGGATCTCCTTTTCAGTCTATCTCTTCCCTAGGCAAAAGGTTT

AACTAAACTAGTAGCAAAGAAATTGAGACTTTGCATCCTGGGGAAGAGATTTATCTCCACCCCATAACTCATAGATGGTAGGTAGGTGTCAGGCAGGGCT

CTCTTTATAGTGTTCTGGTAACCCCTGCTTCTGTTTTCAGATTCATAAGGCATCATTGTTAGTAGTTTATGGAGGCGTTCAAGAGAAAAACCTGCTTGGC

CAAGAGCATTAGCCACCTTCAGATTAACCTGAAAAGAGTTCAAGGTTGACAACAGCATCTTATAGAGACCATCAGGAAAAGAGAGAGGCTTGATCTAAGA

TAATATACCAGTAATTTGCATCACTGAAATTATAAGAAACATCCCCAATTGTTAGCAGATTGCATGGATAATCTCTGTCTCCTTTTTTTGCCCTTACTGT

CTTTCAGGTAGAGGATTGCGAGTATGGGATAGTTAGAGCCATTATGGCACTCAAAGCAGGCTTTGTTCCAGACAGACTCCCATCCCAGGACAACTGAGGC

AAGTGGTAGAGAAGCCTAGGGCTACTTTTACATCTGGGGGAAAAGAAAAGATCTGAGGTAGAACACTGAAGTTATTTCTTGGCAGGGTTTCCATTTGACC

AGAATGTTTCCCACAAAAATCAGAATCCTCATGAGTACAAGAGTGCTTATTCTTTGTCATTTAGCCCTTTCTATGGCTAGAGATTGGAGCAAGAA
Translation
MQWIRGGTGM - UNI37830 - LITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVR LWVNQEDGVEEGPSD

VQNGHLDPNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIKHLKDICE GYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHL

SEIGPCFLEH QDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHS SDYRYVAAAL

AVMRNVTQQINERKRRLENIDKIAQWQASVLDWE GEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKK DLIRRDILYYKGRIDMDKYE

VIDIEDGRDDDFNVSMKNAFKLHNKETEEVHLFFAKKLEEKIRWLRAFREERKMVQEDEKIG GFEISENQKRQAAMTVRKASKQKG GRVGEEKNHSLK

LKRVCEVLQGYYGLLKRNPNQELSTC CVNSARSVPPSYPPPQDPLNQGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
Transcript ENSMUST00000088084
Sequence
ATGACCCAG CTGATCACTGGAGATTCCATCGTTAGTGCTGAGGCAGTATGGGATCACGTCACCATGGCCAACCGGGAGTTGGCATTTAAGGCTGGCGAC

GTCATCAAAGTCTTGGATGCTTCCAACAAGGATTGGTGGTGGGGCCAGATCGACGATGAGGAGGGATGGTTTCCTGCCAGCTTTGTGAGG CTCTGGGTG

AACCAGGAGGATGGGGTGGAGGAAGGGCCCAGTGATGTGCAGAATGGGCACCTGGACCCCAACTCAGACTGCCTTTGTCTGGGCCGGCCACTACAGAACC

GGGACCAGATGCGGGCCAATGTCATCAATGAGATCATGAGCACGGAGCGCCATTACATCAAGCACCTCAAGGACATTTGCGAG GGCTACCTGAAGCAGT

GCCGAAAGAGAAGGGACATGTTCAGTGACGAGCAGCTGAAGGTCATCTTTGGAAACATTGAAGACATATACAGATTTCAGATGGGCTTCGTGAGAGACCT

GGAGAAGCAGTACAACAATGATGATCCCCACCTCAGTGAGATAGGACCCTGCTTCTTAGAGCAT CAAGATGGATTCTGGATATACTCTGAATATTGTAA

CAACCACCTGGATGCCTGCATGGAACTCTCCAAGCTGATGAAGGACAGCCGCTATCAACACTTCTTTGAGGCCTGCCGCCTCTTGCAGCAGATGATCGAC

ATTGCTATTGATGGTTTTCTTTTGACTCCAGTACAGAAGATCTGCAAATATCCCTTACAATTGGCCGAGCTCCTAAAGTATACTGCCCAAGATCACAG T

GATTACAGATACGTTGCAGCTGCTTTGGCTGTCATGAGAAATGTGACTCAGCAGATCAATGAACGCAAGCGACGTCTGGAGAATATTGACAAGATTGCGC

AATGGCAGGCCTCTGTCCTAGACTGGGAG GGAGAGGACATCTTAGACAGGAGCTCGGAGCTGATCTACACTGGAGAGATGGCCTGGATCTACCAGCCCT

ATGGCCGCAACCAGCAGAGAGTCTTCTTCCTGTTTGACCACCAGATGGTCCTCTGCAAGAAG GACCTAATCCGGAGAGACATCCTATACTACAAGGGGC

GCATTGACATGGATAAATATGAGGTAATTGACATCGAAGATGGCAGAGATGATGACTTTAATGTCAGCATGAAAAATGCTTTCAAGCTTCATAACAAGGA

AACGGAAGAAGTGCATCTGTTCTTTGCCAAGAAACTGGAGGAGAAAATACGTTGGCTTAGAGCTTTCAGAGAAGAGAGAAAAATGGTACAAGAAGATGAA

AAAATTG GCTTTGAGATTTCTGAAAATCAGAAGAGACAGGCTGCAATGACTGTGAGAAAAGCTTCTAAACAGAAAG GTGTCAACTCTGCCCGCTCAGT

TCCTCCTTCCTACCCACCACCACAGGACCCGTTAAACCAGGGCCAGTACCTGGTCCCCGATGGCATCGCTCAGTCTCAAGTGTTTGAGTTCACTGAACCG

AAACGCAGCCAGTCACCATTCTGGCAAAACTTCAGTAG GTATTGTGGAAGGATATAA
Translation
MTQ LITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVR LWVNQEDGVEEGPSDVQNGHLDPNSDCLCLGRPLQ

NRDQMRANVINEIMSTERHYIKHLKDICE GYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCFLEH QDGFWIYSE

YCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHS SDYRYVAAALAVMRNVTQQINERKRRLENI

DKIAQWQASVLDWE GEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKK DLIRRDILYYKGRIDMDKYEVIDIEDGRDDDFNVSMKNAF

KLHNKETEEVHLFFAKKLEEKIRWLRAFREERKMVQEDEKIG GFEISENQKRQAAMTVRKASKQKG GVNSARSVPPSYPPPQDPLNQGQYLVPDGIAQ

SQVFEFTEPKRSQSPFWQNFSR RYCGRI
Transcript ENSMUST00000113885
Sequence
GAGTGGCTGGTAGCCTGGAATCCCTTGAAGAGAGCTAGCAGACGAGAGAGATCTTAGGAAGCTGATGAACTAGAAAGAGTAGGGGAGACTGAGACTGACC

GGTAGCCAGCTAGGCAGACAGACGCATGCCCGGACAGACTCTGGAGAACCGATAGGTTCATTTTGCCTTTCTTTTTGAAAAGCAGGATTTTGATTTTTCT

GTGGCGCCCAAGAGAGAATGCTGGACTCTGCTACCTTCAGCTTAAGCTAAGATTTCTCAGTTAGGGAGGAAAGATCAGCCCAGTCCCGAGAGGGGGAGGG

AAGCAAAAGCCCCTGCCTCCAACCCCCTTCCCTCCCCCGGACCAAACTCGGGGACCAAACCCAGACCTTCCCTAACCATCTGACTTCCTCCTTTCCTTTT

TAGCATGGTGGCTGTATGGACAGTCTGACAGAACAGAGATTGACATCTCCCAATCTGCCGGCCCCCCACCTGGAACACTACAGTGTTCTGCATTGCACCA

TGACCCTGGATGTGCAAACTGTAGTCGTTTTTGCCGTGATTGTAGTCCTCCTGCTTGTCAATGTCATACTCATGTTTTTCTTGGGAACGCGCTGAATGGA

GTCCAGCCACCTGAGCTGTTGCGAACTCTCACTTTGATTTCATCCCAAGAGCCTCTGAGGGGGAAAAAATCAGGAGAGACAGTCTGAGACAGGGAAAGAG

AGGGAGAAAAAGAACAAGCTTTCTTACTCAGGGGGGAAAACGTTTTGAGCTTCAACATGGCCTCGCTGTGATATGTATGACGTTG - UNI37830 - C

TGATCACTGGAGATTCCATCGTTAGTGCTGAGGCAGTATGGGATCACGTCACCATGGCCAACCGGGAGTTGGCATTTAAGGCTGGCGACGTCATCAAAGT

CTTGGATGCTTCCAACAAGGATTGGTGGTGGGGCCAGATCGACGATGAGGAGGGATGGTTTCCTGCCAGCTTTGTGAGG CTCTGGGTGAACCAGGAGGA

TGGGGTGGAGGAAGGGCCCAGTGATGTGCAGAATGGGCACCTGGACCCCAACTCAGACTGCCTTTGTCTGGGCCGGCCACTACAGAACCGGGACCAGATG

CGGGCCAATGTCATCAATGAGATCATGAGCACGGAGCGCCATTACATCAAGCACCTCAAGGACATTTGCGAG GGCTACCTGAAGCAGTGCCGAAAGAGA

AGGGACATGTTCAGTGACGAGCAGCTGAAGGTCATCTTTGGAAACATTGAAGACATATACAGATTTCAGATGGGCTTCGTGAGAGACCTGGAGAAGCAGT

ACAACAATGATGATCCCCACCTCAGTGAGATAGGACCCTGCTTCTTAGAGCAT CAAGATGGATTCTGGATATACTCTGAATATTGTAACAACCACCTGG

ATGCCTGCATGGAACTCTCCAAGCTGATGAAGGACAGCCGCTATCAACACTTCTTTGAGGCCTGCCGCCTCTTGCAGCAGATGATCGACATTGCTATTGA

TGGTTTTCTTTTGACTCCAGTACAGAAGATCTGCAAATATCCCTTACAATTGGCCGAGCTCCTAAAGTATACTGCCCAAGATCACAG TGATTACAGATA

CGTTGCAGCTGCTTTGGCTGTCATGAGAAATGTGACTCAGCAGATCAATGAACGCAAGCGACGTCTGGAGAATATTGACAAGATTGCGCAATGGCAGGCC

TCTGTCCTAGACTGGGAG GGAGAGGACATCTTAGACAGGAGCTCGGAGCTGATCTACACTGGAGAGATGGCCTGGATCTACCAGCCCTATGGCCGCAAC

CAGCAGAGAGTCTTCTTCCTGTTTGACCACCAGATGGTCCTCTGCAAGAAG GACCTAATCCGGAGAGACATCCTATACTACAAGGGGCGCATTGACATG

GATAAATATGAGGTAATTGACATCGAAGATGGCAGAGATGATGACTTTAATGTCAGCATGAAAAATGCTTTCAAGCTTCATAACAAGGAAACGGAAGAAG

TGCATCTGTTCTTTGCCAAGAAACTGGAGGAGAAAATACGTTGGCTTAGAGCTTTCAGAGAAGAGAGAAAAATGGTACAAGAAGATGAAAAAATTG GCT

TTGAGATTTCTGAAAATCAGAAGAGACAGGCTGCAATGACTGTGAGAAAAGCTTCTAAACAGAAAG GTGTCAACTCTGCCCGCTCAGTTCCTCCTTCCT

ACCCACCACCACAGGACCCGTTAAACCAGGGCCAGTACCTGGTCCCCGATGGCATCGCTCAGTCTCAAGTGTTTGAGTTCACTGAACCGAAACGCAGCCA

GTCACCATTCTGGCAAAACTTCAGTAG GTATTGTGGAAGGATATAAAACCAAACAGAAACAAAGGAGTGAACGAATGTAATGAGAGTCGAGAAGATTTC

TGTTAGGGGGATAGTTTTTATTTAGGTGATTTCTTCCCATATAACAGCAATGCTAAGCCATTGAAAGTTTCCACCTAAGAATTAGTTTGGGTCCATTAGT

CTCTTTTCCAAGCCTCTTTTGTTATGGATCTCCTTTTCAGTCTATCTCTTCCCTAGGCAAAAGGTTTAACTAAACTAGTAGCAAAGAAATTGAGACTTTG

CATCCTGGGGAAGAGATTTATCTCCACCCCATAACTCATAGATGGTAGGTAGGTGTCAGGCAGGGCTCTCTTTATAGTGTTCTGGTAACCCCTGCTTCTG

TTTTCAGATTCATAAGGCATCATTGTTAGTAGTTTATGGAGGCGTTCAAGAGAAAAACCTGCTTGGCCAAGAGCATTAGCCACCTTCAGATTAACCTGAA

AAGAGTTCAAGGTTGACAACAGCATCTTATAGAGACCATCAGGAAAAGAGAGAGGCTTGATCTAAGATAATATACCAGTAATTTGCATCACTGAAATTAT

AAGAAACATCCCCAATTGTTAGCAGATTGCATGGATAATCTCTGTCTCCTTTTTTTGCCCTTACTGTCTTTCAGGTAGAGGATTGCGAGTATGGGATAGT

TAGAGCCATTATGGCACTCAAAGCAGGCTTTGTTCCAGACAGACTCCCATCCCAGGACAACTGAGGCAAGTGGTAGAGAAGCCTAGGGCTACTTTTACAT

CTGGGGGAAAAGAAAAGATCTGAGGTAGAACACTGAAGTTATTTCTTGGCAGGGTTTCCATTTGACCAGAATGTTTCCCACAAAAATCAGAATCCTCATG

AGTACAAGAGTGCTTATTCTTTGTCATTTAGCCCTTTCTATGGCTAGAGATTGGAGCAAGAACAATAGAATATAAAGAAGTGTGAAAACCCACCCTATCC

AGGAATCTGGAGATTGTGTCTGTCCTGGACCTCACAAGAAAATACTTCATTATAAAAAAAAAAGATCTAAGCTTACCAAGTAGCAACCATAGCTGTATGA

GGTCTTCAAAAAAGCTGAATTTGTACTTCTTGACCTAGATTAAGCCCTACCCCTGAGAATCTTTCCCCTCTGAAAAACAAATTACACATTGTTGTCAGAC

TTTGTAGTTATCAAGGCTAACTAGCAGAATACCAGGGCTCGGGACTGGCTATCACTGCTCAGCATATGATAGAGCTACATAAGCCCTTATGGCAAGAAAT

CTGGCATCGAGCACATAGACTACAATGCTCTCCCTTGGCAAACTGAAATGTGTTTCACTTCCTATGCAGGCCTCCCTTATTGCACCTTCATTTCCTACTT

TCTACCCATTCTCACTAGGCTTGGCCTTGGCAACTTTCTCCCAGGGTTAGGAGCACACCAGGAGGGCTTGTTTTGAAAGGTTTCTAGATCTATAGTATCT

TTTGGCCAGACCTTCTCATTCTTTTCCCCTTTCTGAGTCCAACATTCAAGGCTCCCAGATCAGGGGTATTACCTCTCATCATCCTGTTTCTCCATCCAGT

CCACTAACCTTACAAGATGTAGTAATTTGTGAAGGCACTACCAACTCCGCTCTCCTTGGATTGGAATGCCTGGCTCCACCCTCACACCTACAGCTCCAAA

TAGATCAGTGGCCAGTAGCCCAAAGGGAAACTCATCAATTCCCTGGACTCAGTAGCTGAACCTGCTGCAGCCCCACGGCCATATAATCCCCCCCAAAAAT

AACTCTATACTTCTCCTGTTTCTGCATGGCCCCAGACTCCCCTTTCCTCAACTCAATGAGGCCCGAACTTTCTTTCTCCAGTTTTGTGAGTTTGTTCTAT

GAGTTCTATTATAGGGAGGTCCTAAATACAGAAATACAATTTTTCTCTCCTTCTCTCATCCACTTTCTATGTGTATATCTTTAATTGATCTATTAAGGAC

AGCAGCAAGAGAGTTCTAACAATTCTAGTATGAAGCCAAATAGTGCTATTTTAGTGCTTTGGGGGTGGGGCGGGCTGGGTGACTAGATGGGCAACAGTGA

TTTTGACCCCTGCTGCTCTGCATTTGCCGGCTTATTCTTTTGTTTCTATTATCCGACTGTTTGACCCTGTCAAACAAGTGTCAAAATTGTGTATTTGGAA

ATGTTTAACAACAACAACAACAAAAAAGATGTTGTAATGACATAAAGCCTTATGAAAATATTTATGGAGTTCAATAAAAGAAGTAAAAAA
Translation
MTL - UNI37830 - LITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVR LWVNQEDGVEEGPSDVQNGHLD

PNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIKHLKDICE GYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCF

LEH QDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHS SDYRYVAAALAVMRNVT

QQINERKRRLENIDKIAQWQASVLDWE GEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKK DLIRRDILYYKGRIDMDKYEVIDIEDG

RDDDFNVSMKNAFKLHNKETEEVHLFFAKKLEEKIRWLRAFREERKMVQEDEKIG GFEISENQKRQAAMTVRKASKQKG GVNSARSVPPSYPPPQDPL

NQGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSR RYCGRI

For any suggestions or comments, please send an email to unitrap@crg.es