Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025728 (Pigq)
Chromosomal location
Chr 17: 26063373 - 26078880 (-)
Description
phosphatidylinositol glycan anchor biosynthesis, class Q Gene [Source:MGI Symbol;Acc:MGI:1333114]
RefSeq_dna
NM_011822 
RefSeq_peptide
NP_035952.2 
MGI
MGI:1333114 
Uniprot/SWISSPROT
Q9QYT7 
Uniprot/SPTREMBL
Q3TF56 Q3TD14 
Human Ortholog
ENSG00000007541 (PIGQ)
Omim not available
UniTrap UNI28084
Vector Insertion
Chr 17: 26074408 - 26078759
Public Clones (sanger)
Private Clones OST40319 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000026823
Sequence
GCTGATGTCCCGCGGCGGGCCTGGGAGCCGCAAGCACGGTCGTCCTCCCGGGCCCGCCGAACGCAGTGCCCAACCCAGTTCCTTCCCTACCGCTCGGGGA

CGCGGCCCCGGGGACCAGCTG - UNI28084 - GGCCCCCAGCATGGTGCTCAAGGTCTTCTTCCCCACGTGCTGTGCCTCGGCAGACAGTGGCCTGT

TAGTGGGACGATGGGTTCCAGGACAGAGCAGTGCTGTGATCCTGGCCGTGGTGCACTTTCCCTTCATCCCCATCCAAGTCAAGGAGCTCCTGGCCCAGGT

GCAGAAGGCCAGTCAAGTACCAGTGGCTGTGCTAGGGACCTGGTGCCACCGTCAGCAGGAACCGCAGGAGAGCCTGGGGAATTTCCTGGAGGGCCTGGGC

ACCATCTTCTCCCATGACCCCTGGTTGCAGCTCTGCCGGGAGAGGGGTACCAGACTCTGGAGCTGCAAGGCCACTTACCCGCAGATGTCTAACCCTCTGG

ACATGCACCCCGAAGAGCAGGTCATGCTCATCTTCTATGATCAGCGCAAGCTGCTGCTCTCCTGGTTGCATCCGCCTCCAGTCCTGCCTGCCTGCCAGAT

GGGAGACACCACAGCCAGCACCGGAGGCCTAGCTGACATCTTTGACACAGTGGCACGCAGCGAGGTGCTCTTCCGAAATGACCAATTTGATGAGAGACCC

GTACGCCTGAGCCACTGGCAATCAGAGGGAGTGGAGGCCAGCATACTTGTGGAGTTGGCAAAGCGGGCCTCTGGGCCTGTCTGCCTGCTGCTGGCTTCTC

TGTTGTCCCTGATCTCAGCAGCTAGTGCTTGCCG GCTATGGAAGCTGTGGCCACTTTCCTTCATCAGAAGCAAGCTCTCCACTTGTGAGCAGCTCCATC

ACCGGCTGAAGCACCTCTCCTTCATCTTCAGCACGGAGAAAGCCCAGAATCCCATGCAGCTGATGAG GAAGGCCAACATGCTGGTTTCTGTGCTACTGG

ATGTGGCCCTTGGCTTGCTGCTGCTCTCTTGGCTCCACAGCAATAACCGAATTGGACAGCTGGCCAATGCCCTGGTCCCTGTGGCTGAT CGCGTGGCTG

AGGAGCTCCAGCATCTGCTGCAGTGGCTGATGGGTGCTCCTGCTGGGCTCAAGATGAATCGGGCACTGGATCAGGTGCTAGGCCGCTTTTTCCTGTACCA

CATCCATCTGTGGATAA GCTATATCCACCTTATGTCCCCCTTTATTGAGCATATCCTGTGGCATGTGGGACTCTCAGCCTGCCTTGGACTGACTGTTGC

TCTGTCCATCTTTTCGGATATCATCGCCCTTCTCACCTTCCACATCTATTGCTTCTATGTCTACGGTGCCAG GCTGTACTGCCTGAAGATCTATGGCCT

TTCCTCTCTCTGGCGTCTGTTCCGGGGGAAGAAGTGGAATGTTCTGCGCCAGCGAGTGGATTCTTGTTCCTATGACCTTGACCAG CTCTTCATTGGGAC

CTTGCTCTTCACCATCCTGGTCTTCTTGCTACCCACCACCGCTCTGTACTACCTGGTATTCACCCTG CTCCGGCTCCTGGTGATCACTGTGCAAGGCTT

AATCCATCTACTTGTAGACCTCATCAATTCCCTGCCACTATACTCCCTTGGCCTTCGACTCTGCCGACCCTACAGGCTGGCAG CTGGTGTGAAGTTCAG

AGTTCTGGAAAAGGAGGCAGGCAGACCCCTCCGCCTCCTGATGCAG ATAAACCCCCTGTCCTATAACCATGTGATGCACATCTACCGTCTGCCTCGCTG

TGGCTGCCATCCCAAGCACTCCTGGGGTACCCTGTGCCGAAAGCTGGTCTTCGGAGAGCTCATCTACCCCTGGAGGCAGAGAGAGGACAAACAGGACTGA

GGAGCTGGACACAGCCTACCCATAGCTACTGCACAACCATCACGCCTCCTCTCTGCCAGGACAGCACTGACCACGGGGTCATCTCAGGTCCCACAAGGGC

CAACCAAACACTCTGTGTGCTGAATGTAGGCAGGCCTTACCCTTGAGTTACTACTTTGCTCTCGGACCCTGCCAGCTTCAGTCCTGCACTCTATCTAGCA

CAGTGGTTCTCAACCGTCCCAAAGCTGACCCTTTAATACAGTTCCTCATGTTGTGGTGACCCCAACCATAAAATTATATTCATTACTACTTCATTACTGT

TAATTTTGCTACTGCTATGAATCATGATATAATATAAATATCTGTGTTTTCTGACAGTCATAGGTGAACCCTGTGAAAGTGTCATATGACACCCACCCCA

AAGGGTTGAGAACCACTGCTCTAGTATCACCTATGTAGGGACCCACATGGTTTTTGTAGTCATTACAGTGAGCCTGATTCCTAGGAGTTCCCGGACCCCG

TGGGATATGCTGGCAGGTGCTCTTGGCTGCTTTATTGGGTGGGAGCACTCCTGGGCACCTGGTGTACTTCATAAGCCTCCGCAGAACATTTCCATTGGGA

AACAGGCAGCTGCTGATCCCTTAGCCCCTCGAACTAATCCCTCACCCTGTACTTCATTGGGCTTACTTGCTACTCTGGAGATTGCTTTGTGAAGTTGCTG

TTAATAGGCCTTTGGGTACCCTTTGCTTGAAGTTATATCAACTGAGGTGATTGGATACCTGCCAACCTGGCTAGTGCTCCATGTATGAATAGGCCCTTTG

GCAAAATATTCTATGTTCTCTTATAGACTCCTTATGGGACCAGATAGCTTCCTTCTGGACAGGCACTTCATGGCTCATTGTGTGAATGATCTTGGGGTGG

TGAAATGGCCAGGGTTGGTTCCCTAACACTTAGTGGGACCCCATGTGAGCTAGTCCCTAGGGGGCAGGAAACCTCACTGCCTGAATTGTCTACTGTGGGC

AGGAGGGGACAGCCGGCCCAGCCTGTCTTTCAGGGGCACTTGGGACTATTGACATTGGTCTGTCTGTGCCTGCTTCCTCTTGCTATAGGTCACAGCCACT

CTTAAGCAGCCAGTGGAGGGTTTTGGTGAAGATGAATCCTGATCCTGTGATGACAATAAAAATCTCATGAATCTGG
Translation
 - UNI28084 - MVLKVFFPTCCASADSGLLVGRWVPGQSSAVILAVVHFPFIPIQVKELLAQVQKASQVPVAVLGTWCHRQQEPQESLGNFLEGLGT

IFSHDPWLQLCRERGTRLWSCKATYPQMSNPLDMHPEEQVMLIFYDQRKLLLSWLHPPPVLPACQMGDTTASTGGLADIFDTVARSEVLFRNDQFDERPV

RLSHWQSEGVEASILVELAKRASGPVCLLLASLLSLISAASACR RLWKLWPLSFIRSKLSTCEQLHHRLKHLSFIFSTEKAQNPMQLMR RKANMLVSV

LLDVALGLLLLSWLHSNNRIGQLANALVPVAD RVAEELQHLLQWLMGAPAGLKMNRALDQVLGRFFLYHIHLWIS SYIHLMSPFIEHILWHVGLSACL

GLTVALSIFSDIIALLTFHIYCFYVYGAR RLYCLKIYGLSSLWRLFRGKKWNVLRQRVDSCSYDLDQ LFIGTLLFTILVFLLPTTALYYLVFTL LRL

LVITVQGLIHLLVDLINSLPLYSLGLRLCRPYRLAA AGVKFRVLEKEAGRPLRLLMQ INPLSYNHVMHIYRLPRCGCHPKHSWGTLCRKLVFGELIYP

WRQREDKQD
Transcript ENSMUST00000097368
Sequence
GCTGATGTCCCGCGGCGGGCCTGGGAGCCGCAAGCACGGTCGTCCTCCCGGGCCCGCCGAACGCAGTGCCCAACCCAGTTCCTTCCCTACCGCTCGGGGA

CGCGGCCCCGGGGACCAGCTG - UNI28084 - GGCCCCCAGCATGGTGCTCAAGGTCTTCTTCCCCACGTGCTGTGCCTCGGCAGACAGTGGCCTGT

TAGTGGGACGATGGGTTCCAGGACAGAGCAGTGCTGTGATCCTGGCCGTGGTGCACTTTCCCTTCATCCCCATCCAAGTCAAGGAGCTCCTGGCCCAGGT

GCAGAAGGCCAGTCAAGTACCAGTGGCTGTGCTAGGGACCTGGTGCCACCGTCAGCAGGAACCGCAGGAGAGCCTGGGGAATTTCCTGGAGGGCCTGGGC

ACCATCTTCTCCCATGACCCCTGGTTGCAGCTCTGCCGGGAGAGGGGTACCAGACTCTGGAGCTGCAAGGCCACTTACCCGCAGATGTCTAACCCTCTGG

ACATGCACCCCGAAGAGCAGGTCATGCTCATCTTCTATGATCAGCGCAAGCTGCTGCTCTCCTGGTTGCATCCGCCTCCAGTCCTGCCTGCCTGCCAGAT

GGGAGACACCACAGCCAGCACCGGAGGCCTAGCTGACATCTTTGACACAGTGGCACGCAGCGAGGTGCTCTTCCGAAATGACCAATTTGATGAGAGACCC

GTACGCCTGAGCCACTGGCAATCAGAGGGAGTGGAGGCCAGCATACTTGTGGAGTTGGCAAAGCGGGCCTCTGGGCCTGTCTGCCTGCTGCTGGCTTCTC

TGTTGTCCCTGATCTCAGCAGCTAGTGCTTGCCG GCTATGGAAGCTGTGGCCACTTTCCTTCATCAGAAGCAAGCTCTCCACTTGTGAGCAGCTCCATC

ACCGGCTGAAGCACCTCTCCTTCATCTTCAGCACGGAGAAAGCCCAGAATCCCATGCAGCTGATGAG GAAGGCCAACATGCTGGTTTCTGTGCTACTGG

ATGTGGCCCTTGGCTTGCTGCTGCTCTCTTGGCTCCACAGCAATAACCGAATTGGACAGCTGGCCAATGCCCTGGTCCCTGTGGCTGAT AGTCAAAGCA

GTGTCTCCGTGGAAGTCTTGTGGGCTCTCTTCTGCTCCGTCAGTGCGGATGCCTGCTGGGTCTGTTTGTTGCCAGGCCAGGAATCTGGGGCAGCAGTGGG

CTCCTCTCAGCTTTGTGAGATCTGTGGAGGTCATCCCAGTAGGAAAGAGGAGCTGGAGCTGGGTGAACGG CGCGTGGCTGAGGAGCTCCAGCATCTGCT

GCAGTGGCTGATGGGTGCTCCTGCTGGGCTCAAGATGAATCGGGCACTGGATCAGGTGCTAGGCCGCTTTTTCCTGTACCACATCCATCTGTGGATAA G

CTATATCCACCTTATGTCCCCCTTTATTGAGCATATCCTGTGGCATGTGGGACTCTCAGCCTGCCTTGGACTGACTGTTGCTCTGTCCATCTTTTCGGAT

ATCATCGCCCTTCTCACCTTCCACATCTATTGCTTCTATGTCTACGGTGCCAG GCTGTACTGCCTGAAGATCTATGGCCTTTCCTCTCTCTGGCGTCTG

TTCCGGGGGAAGAAGTGGAATGTTCTGCGCCAGCGAGTGGATTCTTGTTCCTATGACCTTGACCAG CTCTTCATTGGGACCTTGCTCTTCACCATCCTG

GTCTTCTTGCTACCCACCACCGCTCTGTACTACCTGGTATTCACCCTG CTCCGGCTCCTGGTGATCACTGTGCAAGGCTTAATCCATCTACTTGTAGAC

CTCATCAATTCCCTGCCACTATACTCCCTTGGCCTTCGACTCTGCCGACCCTACAGGCTGGCAG CTGGTGTGAAGTTCAGAGTTCTGGAAAAGGAGGCA

GGCAGACCCCTCCGCCTCCTGATGCAG ATAAACCCCCTGTCCTATAACCATGTGATGCACATCTACCGTCTGCCTCGCTGTGGCTGCCATCCCAAGCAC

TCCTGGGGTACCCTGTGCCGAAAGCTGGTCTTCGGAGAGCTCATCTACCCCTGGAGGCAGAGAGAGGACAAACAGGACTGAGGAGCTGGACACAGCCTAC

CCATAGCTACTGCACAACCATCACGCCTCCTCTCTGCCAGGACAGCACTGACCACGGGGTCATCTCAGGTCCCACAAGGGCCAACCAAACACTCTGTGTG

CTGAATGTAGGCAGGCCTTACCCTTGAGTTACTACTTTGCTCTCGGACCCTGCCAGCTTCAGTCCTGCACTCTATCTAGCACAGTGGTTCTCAACCGTCC

CAAAGCTGACCCTTTAATACAGTTCCTCATGTTGTGGTGACCCCAACCATAAAATTATATTCATTACTACTTCATTACTGTTAATTTTGCTACTGCTATG

AATCATGATATAATATAAATATCTGTGTTTTCTGACAGTCATAGGTGAACCCTGTGAAAGTGTCATATGACACCCACCCCAAAGGGTTGAGAACCACTGC

TCTAGTATCACCTATGTAGGGACCCACATGGTTTTTGTAGTCATTACAGTGAGCCTGATTCCTAGGAGTTCCCGGACCCCGTGGGATATGCTGGCAGGTG

CTCTTGGCTGCTTTATTGGGTGGGAGCACTCCTGGGCACCTGGTGTACTTCATAAGCCTCCGCAGAACATTTCCATTGGGAAACAGGCAGCTGCTGATCC

CTTAGCCCCTCGAACTAATCCCTCACCCTGTACTTCATTGGGCTTACTTGCTACTCTGGAGATTGCTTTGTGAAGTTGCTGTTAATAGGCCTTTGGGTAC

CCTTTGCTTGAAGTTATATCAACTGAGGTGATTGGATACCTGCCAACCTGGCTAGTGCTCCATGTATGAATAGGCCCTTTGGCAAAATATTCTATGTTCT

CTTATAGACTCCTTATGGGACCAGATAGCTTCCTTCTGGACAGGCACTTCATGGCTCATTGTGTGAATGATCTTGGGGTGGTGAAATGGCCAGGGTTGGT

TCCCTAACACTTAGTGGGACCCCATGTGAGCTAGTCCCTAGGGGGCAGGAAACCTCACTGCCTGAATTGTCTACTGTGGGCAGGAGGGGACAGCCGGCCC

AGCCTGTCTTTCAGGGGCACTTGGGACTATTGACATTGGTCTGTCTGTGCCTGCTTCCTCTTGCTATAGGTCACAGCCACTCTTAAGCAGCCAGTGGAGG

GTTTTGGTGAAGATGAATCCTGATCCTGTGATGACAATAAAAATCTCATGAATCTGG
Translation
 - UNI28084 - MVLKVFFPTCCASADSGLLVGRWVPGQSSAVILAVVHFPFIPIQVKELLAQVQKASQVPVAVLGTWCHRQQEPQESLGNFLEGLGT

IFSHDPWLQLCRERGTRLWSCKATYPQMSNPLDMHPEEQVMLIFYDQRKLLLSWLHPPPVLPACQMGDTTASTGGLADIFDTVARSEVLFRNDQFDERPV

RLSHWQSEGVEASILVELAKRASGPVCLLLASLLSLISAASACR RLWKLWPLSFIRSKLSTCEQLHHRLKHLSFIFSTEKAQNPMQLMR RKANMLVSV

LLDVALGLLLLSWLHSNNRIGQLANALVPVAD SQSSVSVEVLWALFCSVSADACWVCLLPGQESGAAVGSSQLCEICGGHPSRKEELELGER RVAEEL

QHLLQWLMGAPAGLKMNRALDQVLGRFFLYHIHLWIS SYIHLMSPFIEHILWHVGLSACLGLTVALSIFSDIIALLTFHIYCFYVYGAR RLYCLKIYG

LSSLWRLFRGKKWNVLRQRVDSCSYDLDQ LFIGTLLFTILVFLLPTTALYYLVFTL LRLLVITVQGLIHLLVDLINSLPLYSLGLRLCRPYRLAA AG

VKFRVLEKEAGRPLRLLMQ INPLSYNHVMHIYRLPRCGCHPKHSWGTLCRKLVFGELIYPWRQREDKQD

For any suggestions or comments, please send an email to unitrap@crg.es