Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025759 (Mfsd8)
Chromosomal location
Chr 3: 40622094 - 40650776 (-)
Description
major facilitator superfamily domain containing 8 Gene [Source:MGI (curated);Acc:Mfsd8-001]
RefSeq_dna
NM_028140 
RefSeq_peptide
NP_082416.2 
MGI
MGI:1919425 
Uniprot/SWISSPROT
Q8BH31 
Human Ortholog
ENSG00000164073 (MFSD8)
Omim 610951 - CEROID LIPOFUSCINOSIS, NEURONAL, 7  
UniTrap UNI27350
Vector Insertion
Chr 3: 40643428 - 40650562
Public Clones IST15049D10 (tigm)
Private Clones OST62214 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000026859
Sequence
CACACTTCACATTTCCCTTCGGCTGCCGGTCCGCTTCCGGCCTCACGGCGCGCAAGCGCACTCGTAGGAGTGTTTTGACAGCTCCGGGCCTGGAGAAGGA

GCAGGTGTCGCGAGAGTGGGCAGCGCGCCGCCTAGCGAGAGCTGGAATTATGGCGAACCTGGGAAGTGAGGCCGAGCGGGAGCCCCTCTTGGGCCCGGGA

TCACCCGGAAGCAG - UNI27350 - AGAATGGAGCGAGATAGAAACCCAAGAGCATTACAAGAGTAGATGGAAGTCTGTGAGGATTCTCTACCTTAC

CATGTTCCTCAGCAGTGTGG GTTTTTCTATTGTGATAATGTCCATCTGGCCATATCTTCAAAAG ATTGATCAGACAGCTGATGCAAGTTTTTTGGGCT

GGGTTATTGCTTCATATAGTCTTGGCCAAATGGTAGCTTCACCTCTATTTGGCTTATGGTCTAATTATAGGCCGAGAAAAGAACCTCTTATCGTCTCCAT

CTCTATTTCGGTGGCAGCCAACTGCCTATATGCGTATGTCCACGTGCCAGCTGCTCATAATAAATACTACATGTTGATTGCTCGTGGATTGGTGGGATTT

GGAGCAG GAAATGTTGCCGTTGTCCGATCATACATTGCTGGTGCTACTTCCCTTCAGGAAAGAACAAATGCCATGGCTAATACAAGCACATGCCAAGCC

CTGGGCTTTATTCTCGGTCCAG TTTTTCAGACTTGCTTTGCACTCATTGGAGAAAAAGGTGTGACGTGGGACATCATCAAGCTGCAGGTCAACATGTAC

ACAGCACCAGTTTTACTTGCAGCCTTCCTGGGAATTCTAAACATTATTCTGATTCTTTTTATATTAAG AGAGCATCGTGTGGATGACTTGGGACGTCAG

TGTAAGAGTGTGAATTTTCAAGAAG AAAATACAGATGAACCTCAGATTCCTGAAGGAAGTATTGATCAAGTTGCTGTTGTGGCTACCAATATTGTGTTT

TTTGTGGTTTTATTTATCTTTGCTGTTTATGAAAC AATCCTCACCCCACTAACACTGGATATGTACGCCTGGACCCAGGAGCAGGCTGTGCTCTATGAT

GGAATCCTCCTTGTTGCTTTTGGAGTTGAGGCAGTTCTTGTCTTCATGGGGGTTAAATTACTTTCCAAAAA GATTGGCGAGCGTGCTATTCTCCTGGGA

GGATTTGTGGTTGTATGGGTCGGCTTCTTTATCTTGTTACCCTGGGGAAATCAGTTTCCCAAAATACAGTGGGAAG ATTTACACAACAGCTCAACCCCT

AATACTACATTTGGGGAAATAATTATTGGTCTTTGGAATTCTTCAAGAGAAGATCACAGTGAACAGCCAACTGGGTGCCCAATTGAACAGACCTGGTGCC

TGTACACCCCAGTGATTCATCTGGCCCAGTTCCTGACAGCTGCTGTGTTAATTGGAACAGGCTATCCAGCCTGCAGTGTCATGTCCTATACATTATACTC

AAAAGTTCTAGGACCCAAACCTCAG GGTATATACATGGGCTGGTTAACCACTTCTGGAAGTGCAGCACGGATTCTTGGGCCTGTGTTCATCAGCCATGT

GTACACTTACTTGGGCCCACGATGGGCATTCAGCCTTGTGTGTGGAATAGTAGTGCTCACCATCTTGCTAATAGGAGCTGTTTACAAAAGACTCGTTGCC

TTTTCTGTCAGATATATGAGGATCCAGGAGTAAGTTAGAGAGTCTGTGCTGTCTACTGTCTTCAACTCAACACTGAGTAACTTGACTTTGAATGGTAGGA

TGTATAAAAACATTCTGGGTATAATCTCCTTATCAAAGGTGAACTGCTTTCATATCATACTTTACTGGAGTCCCATGAACTCAACAGTGAAAAGATAATG

GTCTGTAGGTATGAAACTACACTTAGTGTGAACTGTAGGGCTCTGTATAAAGCAATGGACTATGCAGTGGAACTGGACAAAAGTTCTGTATTAATCAGAG

CCAACATTTAGTTTAAAAAATGAAACATTTTTTAAACTAAATAAAAATATTTTTTCATTAATGTTTTTTAAAAATAAAAATGCATTATTATTCAGCTTCC

TAATGAAATAAAACTGAGCCTTAAAACCTGAACACCATTCTTTCCACCTTATACTACATGGTCTTCTGAAGCTGTCAGCAGTAAATGATGGCAGGCAGCA

TTTTCCTTCAGCCACTTTGTTTTGTTGGACCCTGGATATCCTCTCCTGCCTTTCTGTGTTTTCTTTCATCTTTGGGTCACTGCTGACCTTAAAATTCCAC

CTTTGTGTGGTATGCCCAGAGACAGAAATAACCAGTGAGAATGAGAGCACGCCAACGTTTCTGTGTAATTCACAGTAGTTTCTCACAGCAAGCTTAGAGC

TGAAGGTAAGATCCTGATCTGTGATACATATGAATGAAGTATACAAGTCGCTTGTCTTTAGAGGCTACCTCATGATTGCTGCACTTCCTACAGGAAAACT

GACCTGAACACTAACAGTTCTTCAATTGCAAGAAACCATTTCTACTTGTGACTCAGATTTGCAGATATTTGGGGAAAAAGTAAAGTGCACTGAGTGAAGA

AGCCTTTATCTTAGCATACATGTTCCCACCAAGAACATGACAGACATTTCCCAGCCCTAGAATTCTAATACTGCCATTCAGAAAGCTACAACCCAGCAAA

ATGACTGCACCTTCTTTTTTACTGAGACACTCGCTTCCTGGGAGATTAGACTAACATCACCTCAACACCAAAGTGAAGTAAGAGGTATAGGGGAGGGAGC

TGAGAGGTAAAAACTGTTAATAGTGTATATTAAAGAAGGAGTGAAAAAAAAAGGAGTGAAAGGGGCAATGGTCTTATTTTTGCAAATCTAGCAAAGGATT

ATTTTCTTATTCTGAATGTATTGTCACTTCATAAAGCATCTCTAGCCATTATGCTTTTCTATTTAAAACAAGCTCTTTTCTTGTATGAAAATGAAATAAG

CTTGTGAATTTTAATTTAATGAAGATAAACTACTATTTGGATCTGACTACCATTTACTGTTGAAGATTTATTTGT
Translation
MANLGSEAEREPLLGPGSPGSR - UNI27350 - REWSEIETQEHYKSRWKSVRILYLTMFLSSVG GFSIVIMSIWPYLQK IDQTADASFLGWVIA

SYSLGQMVASPLFGLWSNYRPRKEPLIVSISISVAANCLYAYVHVPAAHNKYYMLIARGLVGFGAG GNVAVVRSYIAGATSLQERTNAMANTSTCQALG

FILGPV VFQTCFALIGEKGVTWDIIKLQVNMYTAPVLLAAFLGILNIILILFILR REHRVDDLGRQCKSVNFQEE ENTDEPQIPEGSIDQVAVVATN

IVFFVVLFIFAVYET TILTPLTLDMYAWTQEQAVLYDGILLVAFGVEAVLVFMGVKLLSKK KIGERAILLGGFVVVWVGFFILLPWGNQFPKIQWED 

DLHNSSTPNTTFGEIIIGLWNSSREDHSEQPTGCPIEQTWCLYTPVIHLAQFLTAAVLIGTGYPACSVMSYTLYSKVLGPKPQ GIYMGWLTTSGSAARI

LGPVFISHVYTYLGPRWAFSLVCGIVVLTILLIGAVYKRLVAFSVRYMRIQE

For any suggestions or comments, please send an email to unitrap@crg.es