Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025766 (D3Ertd751e)
Chromosomal location
Chr 3: 41546543 - 41562852 (+)
Description
UPF0462 protein C4orf33 homolog  [Source:UniProtKB/Swiss-Prot;Acc:Q8BGN2]
RefSeq_dna
NM_028667 
RefSeq_peptide
NP_081547.1 NP_082943.2 NP_001093255.1 
MGI
MGI:1289213 
Uniprot/SWISSPROT
Q8BGN2 
Human Ortholog
ENSG00000151470 (C4orf33)
Omim not available
UniTrap UNI34256
Vector Insertion
Chr 3: 41548735 - 41550469
Public Clones IST13016B5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000120167
Sequence
TTCCGCAGTGGCGCAGCGAGTGTCTGTCTGAG AATTCCTAGTTCCTCCCTCTAGAACGCAGGAGCAACTGGGCAGAGCCTAAGAGGGAGCTCACTGCTC

AGACCTGGGCCAGAGACCACAGCTAGCACCAAACTTAGAAGAGCTTCCAG - UNI34256 - ATGGATTTTAAAATCGAATACACTTGGGATGGTTTC

CCAGTGAGACATGAGCCAGTGTGTGTCAGGCTGAGTCCGTGTGAGCAGGGAGTGAAGATGGAGGTTAGTGCTCCATTATTCAATGATCCTCCATCCCCTC

TCGGAGAACCAGGAAAGCCTTTCAGTGAACTGTGGAATTATGAAG TTGTGGAAGCATTTTTTTTGAATGATACAACTAAGCAGTATTTAGAAGTCGAAC

TTTGTCC CCATCGTCTAGAATATTTCAAGCCTTTCAGTTTCAACACACTGCTTGGAGAAGAATGGAGGCAGCCAGAACCAGACCTGTGGTAATCTAATA

AATTACATAAACACA
Translation
  - UNI34256 - MDFKIEYTWDGFPVRHEPVCVRLSPCEQGVKMEVSAPLFNDPPSPLGEPGKPFSELWNYEV VVEAFFLNDTTKQYLEVELCP P

HRLEYFKPFSFNTLLGEEWRQPEPDLW
Transcript ENSMUST00000026868
Sequence
AGTGGCGCAGCGAGTGTCTGTCTGAG AATTCCTAGTTCCTCCCTCTAGAACGCAGGAGCAACTGGGCAGAGCCTAAGAGGGAGCTCACTGCTCAGACCT

GGGCCAGAGACCACAGCTAGCACCAAACTTAGAAGAGCTTCCAG - UNI34256 - ATGGATTTTAAAATCGAATACACTTGGGATGGTTTCCCAGTG

AGACATGAGCCAGTGTGTGTCAGGCTGAGTCCGTGTGAGCAGGGAGTGAAGATGGAGGTTAGTGCTCCATTATTCAATGATCCTCCATCCCCTCTCGGAG

AACCAGGAAAGCCTTTCAGTGAACTGTGGAATTATGAAG TTGTGGAAGCATTTTTTTTGAATGATACAACTAAGCAGTATTTAGAAGTCGAACTTTGTC

C GCATGGACAACATTTAGTTCTTTTACTAGCTGGAAGAAGAAATGTTTGGAAA AAAGAGCTCCCATTATCATTCAAAGCGTCCAGAGGAGGGACTAAT

TGGGAAGGTGAAGCTTATATTCCTTGGAGTTATTTCCCACCAAATGTGACAAAATTTAACTCATTTGCAATCCATGGATCAAATGATAGGAGAGTTTATG

AGGCACTTTACCCTGTGCCACAGCATGAGCTACAACAAGGACAAAAACCTGACTT CCATCGTCTAGAATATTTCAAGCCTTTCAGTTTCAACACACTGC

TTGGAGAAGAATGGAGGCAGCCAGAACCAGACCTGTGGTAATCTAATAAATTACATAAAC
Translation
  - UNI34256 - MDFKIEYTWDGFPVRHEPVCVRLSPCEQGVKMEVSAPLFNDPPSPLGEPGKPFSELWNYEV VVEAFFLNDTTKQYLEVELCP P

HGQHLVLLLAGRRNVWK KELPLSFKASRGGTNWEGEAYIPWSYFPPNVTKFNSFAIHGSNDRRVYEALYPVPQHELQQGQKPDF FHRLEYFKPFSFNT

LLGEEWRQPEPDLW
Transcript ENSMUST00000026867
Sequence
GAGGCCGCGTTGGGGGCTGAGTGGGTTGCTTGGCGCCTTCCGCAGTGGCGCAGCGAGTGTCTGTCTGAG - UNI34256 - ATGGATTTTAAAATCGA

ATACACTTGGGATGGTTTCCCAGTGAGACATGAGCCAGTGTGTGTCAGGCTGAGTCCGTGTGAGCAGGGAGTGAAGATGGAGGTTAGTGCTCCATTATTC

AATGATCCTCCATCCCCTCTCGGAGAACCAGGAAAGCCTTTCAGTGAACTGTGGAATTATGAAG TTGTGGAAGCATTTTTTTTGAATGATACAACTAAG

CAGTATTTAGAAGTCGAACTTTGTCC CCATCGTCTAGAATATTTCAAGCCTTTCAGTTTCAACACACTGCTTGGAGAAGAATGGAGGCAGCCAGAACCA

GACCTGTGGTAATCTAATAAATTACATAAACACATTTCTACAACAAACATTTTAACAGAGATCACCAAAATGTAGTATCTCTGTGGTAAATTGTATACAG

TGAACAAAGAAATAGAAACTCTGTGTAGCATAAAATAATTTTTACTTAATTCCTCTCCACACTTGAAATCAGTACAAAACAATACTCTATTTTAGTTGAT

GAGACTATCTATATCTGCTAAGGCATCAAGATAGAGGAGTTATCTAACTAGATATTTTTACTGAGTAAGAAGAAATGAAATAGTCTTGAATTAAGGAAAT

GGAGTTGATAATTTTACTTATAGATAAATGGTATTTTCTTAATGTTGCTAAAAAAGATGTCAGAAACCTTCATTTGATTTTTGAAGTGTCAATCCTGGTT

GAAGATTGTTCCAATATAATAAATCAGTACCCCTGTCTCACATAAACGGGTCATGCAGACAAAAACTAAACAAGAGGAGCCTAAGAGTGAAACTGCACCT

CAGATCAACTAGACACAGCTGCAGAGTTCTTCCAGCAGCTGCAGAATGAACTCTGTTTTCAGAGGCTTATCGAACATGTTCCAGAATAAAACCAGTAACA

CATTTGTTGCAATTCAGGGAGCTGTAGCTACTTGGGTTTATTTATACTAGAAGACTTTTAGATCTGATAAACAAATTCAGCCAAGTGGCACACAACACAG

TCAGAATACATACAAAAATAATAGATTTTCCACACCCCATTAACCAACCTGCTGAGAAATCAGGAATGCATTTCCACTCTCAGCAAAAAGAATAGTTAGG

AACAAGCTTGTGCCTGTTTGTTAATTACCTTTCTCATGGTGTCTAAAAGATAATTGACAAAAGCAAGTCTGCGAAGGAAGGATTTGTATTGGCTCACAGT

GCTGGTTACACTCCTTCATAATGGGGAAAATATGGCTACAGGAATGTGAGGTGCCTGGTCACATGTGTCTACAGTTAAAAAGCAGAGATGAATGGTGTGC

TCAGCTCACTTTGTCATTTTCATTCAGCCGTGGACCCTGTCCTGTGGAATGATGTAGACCTCATTCTGGGTACGCTTGCTGTTCTCAAACCTTTTTAAAA

ACACTCACACGGACATATTGATGAGAGCAGCTCCTAGGTTATTCTAACTCCATGTAAGCGGGCAGGGAGACTAGTCATCATATCTTGCTGAGGTGGTGAA

AGGCTTCTACAATGAAAGTTACAGAGCTTTTGAGAGAGAAATTAAAGAAGACACTAGAAGATGAAAAGACATTCCATGTTCTTAGATCAGCAGATTTAGT

ATTGGGGAAATGGCCATATGAAAATGAGCTATCTAGAAGTTTTTATGATCACTTTCAAAATTTAGATGACATTCTTCACATAGCTAGAACAGTATCCTAA

AATGTGCTTGCAAACACAAAAGACCTATAATAGGCAAAGATGTCCTGAGTACCAAGAACATTATTGGAAGTTCCTAATATTTGGTTTCAAGTTATACTAC

ATAGTTGTAGTAATAAATGGGACCAGCATAAAAATAAGCAATAGAGCCATGAACTAGGGCAGAGGATCCAAAACATCCTACACAGCTGTAGATACTTAAA

TTTTGACTAAGGAATAAAAAACACTCATGAGAAACAATTTCCTCAACCATTGATGCTGGGAAAATAGTATATTGATATGGAACAGTAGAGATAAATCCCC

ATATCCTGCCCTGTACATAAATTAGCCCCAAGACCTTAATATAAGATCTGAAACATTGAAGTCAAAAGAAATAAAAGAATCAACAAAATGAATTTCATCA

AATTAAAAAGCTGCATATGAAAGGAGATAATTAATGAAGTGAAGAGACAGACTATAGCAGGGGAGAATCAGAGTCCTAACATCCAGCATATCCGAAGTAC

TTAGAAAAACACCACCCCAGCAAGGGAGGGCAAAGTGCAATCAATAAGCAGGCAGATCATCTACACAGTTCTCAAAAGAACTTGTATAGGTAGCTAATGA

TTATAAAAAACTTAGTGTCTTTAGGTATTAGGAACATGCATGTTAAAAAACTGCATTGAGATTTCATTTCATCCCAGTAAAAATGACTATCCTGAAGAAA

GCAACAAATGCTGGTGAGGGTAAGGAGAAAGAGTTCAAATCCTCTATTCTTGGAGACTTATATTAGTATTGTCAACAGTGGAGCTATACTGAAAATAGAG

CTGCATATGGTCCAGCTCTACCACTTTGAGTACATCCCCCAGGGAATCTGAATCAGCATAGCTGTGTTCATCACACTAGCCAAGCTATGGTGCCGGTCTA

GGTGTCTGCCTACGGATGAATGGATAAAGAAAACACACGCACACGCACGCAAGACAGCACAGAGAAATGGCATACCATTCAGCC
Translation
 - UNI34256 - MDFKIEYTWDGFPVRHEPVCVRLSPCEQGVKMEVSAPLFNDPPSPLGEPGKPFSELWNYEV VVEAFFLNDTTKQYLEVELCP PH

RLEYFKPFSFNTLLGEEWRQPEPDLW
Transcript ENSMUST00000108065
Sequence
GAGGCCGCGTTGGGGGCTGAGTGGGTTGCTTGGCGCCTTCCGCAGTGGCGCAGCGAGTGTCTGTCTGAG - UNI34256 - ATGGATTTTAAAATCGA

ATACACTTGGGATGGTTTCCCAGTGAGACATGAGCCAGTGTGTGTCAGGCTGAGTCCGTGTGAGCAGGGAGTGAAGATGGAGGTTAGTGCTCCATTATTC

AATGATCCTCCATCCCCTCTCGGAGAACCAGGAAAGCCTTTCAGTGAACTGTGGAATTATGAAG TTGTGGAAGCATTTTTTTTGAATGATACAACTAAG

CAGTATTTAGAAGTCGAACTTTGTCC GCATGGACAACATTTAGTTCTTTTACTAGCTGGAAGAAGAAATGTTTGGAAA AAAGAGCTCCCATTATCATT

CAAAGCGTCCAGAGGAGGGACTAATTGGGAAGGTGAAGCTTATATTCCTTGGAGTTATTTCCCACCAAATGTGACAAAATTTAACTCATTTGCAATCCAT

GGATCAAATGATAGGAGAGTTTATGAGGCACTTTACCCTGTGCCACAGCATGAGCTACAACAAGGACAAAAACCTGACTT CCATCGTCTAGAATATTTC

AAGCCTTTCAGTTTCAACACACTGCTTGGAGAAGAATGGAGGCAGCCAGAACCAGACCTGTGGTAATCTAATAAATTACATAAACACATTTCTACAACAA

ACATTTTAACAGAGATCACCAAAATGTAGTATCTCTGTGGTAAATTGTATACAGTGAACAAAGAAATAGAAACTCTGTGTAGCATAAAATAATTTTTACT

TAATTCCTCTCCACACTTGAAATCAGTACAAAACAATACTCTATTTTAGTTGATGAGACTATCTATATCTGCTAAGGCATCAAGATAGAGGAGTTATCTA

ACTAGATATTTTTACTGAGTAAGAAGAAATGAAATAGTCTTGAATTAAGGAAATGGAGTTGATAATTTTACTTATAGATAAATGGTATTTTCTTAATGTT

GCTAAAAAAGATGTCAGAAACCTTCATTTGATTTTTGAAGTGTCAATCCTGGTTGAAGATTGTTCCAATATAATAAATCAGTACCCCTGTCTCACATAAA

CGGGTCATGCAGACAAAAACTAAACAAGAGGAGCCTAAGAGTGAAACTGCACCTCAGATCAACTAGACACAGCTGCAGAGTTCTTCCAGCAGCTGCAGAA

TGAACTCTGTTTTCAGAGGCTTATCGAACATGTTCCAGAATAAAACCAGTAACACATTTGTTGCAATTCAGGGAGCTGTAGCTACTTGGGTTTATTTATA

CTAGAAGACTTTTAGATCTGATAAACAAATTCAGCCAAGTGGCACACAACACAGTCAGAATACATACAAAAATAATAGATTTTCCACACCCCATTAACCA

ACCTGCTGAGAAATCAGGAATGCATTTCCACTCTCAGCAAAAAGAATAGTTAGGAACAAGCTTGTGCCTGTTTGTTAATTACCTTTCTCATGGTGTCTAA

AAGATAATTGACAAAAGCAAGTCTGCGAAGGAAGGATTTGTATTGGCTCACAGTGCTGGTTACACTCCTTCATAATGGGGAAAATATGGCTACAGGAATG

TGAGGTGCCTGGTCACATGTGTCTACAGTTAAAAAGCAGAGATGAATGGTGTGCTCAGCTCACTTTGTCATTTTCATTCAGCCGTGGACCCTGTCCTGTG

GAATGATGTAGACCTCATTCTGGGTACGCTTGCTGTTCTCAAACCTTTTTAAAAACACTCACACGGACATATTGATGAGAGCAGCTCCTAGGTTATTCTA

ACTCCATGTAAGCGGGCAGGGAGACTAGTCATCATATCTTGCTGAGGTGGTGAAAGGCTTCTACAATGAAAGTTACAGAGCTTTTGAGAGAGAAATTAAA

GAAGACACTAGAAGATGAAAAGACATTCCATGTTCTTAGATCAGCAGATTTAGTATTGGGGAAATGGCCATATGAAAATGAGCTATCTAGAAGTTTTTAT

GATCACTTTCAAAATTTAGATGACATTCTTCACATAGCTAGAACAGTATCCTAAAATGTGCTTGCAAACACAAAAGACCTATAATAGGCAAAGATGTCCT

GAGTACCAAGAACATTATTGGAAGTTCCTAATATTTGGTTTCAAGTTATACTACATAGTTGTAGTAATAAATGGGACCAGCATAAAAATAAGCAATAGAG

CCATGAACTAGGGCAGAGGATCCAAAACATCCTACACAGCTGTAGATACTTAAATTTTGACTAAGGAATAAAAAACACTCATGAGAAACAATTTCCTCAA

CCATTGATGCTGGGAAAATAGTATATTGATATGGAACAGTAGAGATAAATCCCCATATCCTGCCCTGTACATAAATTAGCCCCAAGACCTTAATATAAGA

TCTGAAACATTGAAGTCAAAAGAAATAAAAGAATCAACAAAATGAATTTCATCAAATTAAAAAGCTGCATATGAAAGGAGATAATTAATGAAGTGAAGAG

ACAGACTATAGCAGGGGAGAATCAGAGTCCTAACATCCAGCATATCCGAAGTACTTAGAAAAACACCACCCCAGCAAGGGAGGGCAAAGTGCAATCAATA

AGCAGGCAGATCATCTACACAGTTCTCAAAAGAACTTGTATAGGTAGCTAATGATTATAAAAAACTTAGTGTCTTTAGGTATTAGGAACATGCATGTTAA

AAAACTGCATTGAGATTTCATTTCATCCCAGTAAAAATGACTATCCTGAAGAAAGCAACAAATGCTGGTGAGGGTAAGGAGAAAGAGTTCAAATCCTCTA

TTCTTGGAGACTTATATTAGTATTGTCAACAGTGGAGCTATACTGAAAATAGAGCTGCATATGGTCCAGCTCTACCACTTTGAGTACATCCCCCAGGGAA

TCTGAATCAGCATAGCTGTGTTCATCACACTAGCCAAGCTATGGTGCCGGTCTAGGTGTCTGCCTACGGATGAATGGATAAAGAAAACACACGCACACGC

ACGCAAGACAGCACAGAGAAATGGCATACCATTCAGCC
Translation
 - UNI34256 - MDFKIEYTWDGFPVRHEPVCVRLSPCEQGVKMEVSAPLFNDPPSPLGEPGKPFSELWNYEV VVEAFFLNDTTKQYLEVELCP PH

GQHLVLLLAGRRNVWK KELPLSFKASRGGTNWEGEAYIPWSYFPPNVTKFNSFAIHGSNDRRVYEALYPVPQHELQQGQKPDF FHRLEYFKPFSFNTL

LGEEWRQPEPDLW
Transcript ENSMUST00000119572
Sequence
GCCTTCCGCAGTGGCGCAGCGAGTGTCTGTCTGAGGTAGTGTGGCGCATTTTTAATTTAATTAATTTTTTTTTTTTTGTATGGAAACTGTGATAGGAGCA

GGCACTAACTAGGTAGGGATTTTCATTGCCCACCCCCGAGTCTTGGTTTTGCAGACACTAAGCGTCTGTGGGAGTCTGTGCAGAGAGGTCTGTGAGTCCT

CGGGCTGAGGTGACTCAAGGTCCCCTCACCCCGCCCCCCAGTTTAGAGCTGTCGCTCCTAGGTCTGAAACTGGTTCTTGTGCCTAGAAAAGAGAACTATT

GTCCAATATTTAACCCTGTGGCTTCAAGAAGGCACCTGGTCAGGATCCAGGATAGCCTGCAAATCTAGCAG - UNI34256 - ATGGATTTTAAAATC

GAATACACTTGGGATGGTTTCCCAGTGAGACATGAGCCAGTGTGTGTCAGGCTGAGTCCGTGTGAGCAGGGAGTGAAGATGGAGGTTAGTGCTCCATTAT

TCAATGATCCTCCATCCCCTCTCGGAGAACCAGGAAAGCCTTTCAGTGAACTGTGGAATTATGAAG TTGTGGAAGCATTTTTTTTGAATGATACAACTA

AGCAGTATTTAGAAGTCGAACTTTGTCC CCATCGTCTAGAATATTTCAAGCCTTTCAGTTTCAACACACTGCTTGGAGAAGAATGGAGGCAGCCAGAAC

CAGACCTGTG TTGAAGAAAAGAAAACACCTGAATATACAAGAGGAGACTATTAGAGAAGTGGAAGAGGATTTAAGGAGAGATGGGTGAAAAGATGGAGT

GGGGAATAAAAAATGTCTATAGTTGTATACATGGATGGATCTGCCAATGTAAAACCTGCTATTCTGTGTAATCTTATCCAAGTAAAAATGGCTGTTTTCA

AGAGAAGAACAAATGCTGGTGAGGGGAAGAAGGAAAAAGATCTGTGTCTATTATTTATATTAGTATTATTAACTGTGAAAATCAATATGCTGATACACAA

ATTAAAAGTTTCTTGTCT
Translation
 - UNI34256 - MDFKIEYTWDGFPVRHEPVCVRLSPCEQGVKMEVSAPLFNDPPSPLGEPGKPFSELWNYEV VVEAFFLNDTTKQYLEVELCP PH

RLEYFKPFSFNTLLGEEWRQPEPDLC C

For any suggestions or comments, please send an email to unitrap@crg.es