Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025812 (Pard3)
Chromosomal location
Chr 8: 129588145 - 130134730 (+)
Description
par-3 (partitioning defective 3) homolog (C. elegans) Gene [Source:MGI Symbol;Acc:MGI:2135608]
RefSeq_dna
NM_033620 NM_001013581 NM_001013580 
RefSeq_peptide
NP_296369.2 NP_001116322.1 NP_001013599.1 NP_001013598.1 
UniGene
Mm.299254 Mm.470533 
MGI
MGI:2135608 
Uniprot/SWISSPROT
Q99NH2 
Uniprot/SPTREMBL
A5D6P2 Q4JJC0 Q8BPQ4 Q8BPQ6 Q8CB21 Q58T10 Q58T11 
Human Ortholog
ENSG00000148498 (PARD3)
Omim not available
UniTrap UNI29364
Vector Insertion
Chr 8: 129588144 - 129588374
Public Clones Ayu21-T79 (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20252
Vector Insertion
Chr 8: 129588374 - 129685109
Public Clones D093C12 (ggtc) IST15079F6 (tigm) IST12823D4 (tigm) IST12426G10 (tigm)
IST11176E4 (tigm) IST10922D1 (tigm) IST15088C5 (tigm) IST10951D5 (tigm)
Private Clones OST368752 (lexicon) OST347590 (lexicon) OST285118 (lexicon) OST148510 (lexicon)
OST135738 (lexicon) OST113332 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26820
Vector Insertion
Chr 8: 129800920 - 129801102
Public Clones not available
Private Clones OST93851 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11035
Vector Insertion
Chr 8: 129801102 - 129830209
Public Clones W031F01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3236
Vector Insertion
Chr 8: 129830229 - 129830409
Public Clones AL0593 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3227
Vector Insertion
Chr 8: 129848073 - 129881174
Public Clones AN0736 (sanger) AT0380 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4915
Vector Insertion
Chr 8: 129902215 - 129904364
Public Clones AP0568 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI896
Vector Insertion
Chr 8: 129984285 - 129998278
Public Clones BC0614 (sanger) BC0446 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6919
Vector Insertion
Chr 8: 129998516 - 130116960
Public Clones RRZ644 (baygenomics) IST13601G10 (tigm)
Private Clones OST301855 (lexicon) OST209921 (lexicon) OST48725 (lexicon) OST40810 (lexicon)
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27791
Vector Insertion
Chr 8: 130117082 - 130126958
Public Clones not available
Private Clones OST48724 (lexicon)
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000026921
Sequence
CTGCTCGCGCCTCTAGCCGCCGGCGCGCCGGCGCAGCGGCCCCACCGCGCCCTGCGTACAGTCTCCCGGCCCAGCGCCGCTCCGGCCACGGACAGCGAGG

GACGGCGGCATGAAAGTGACCGTGTGCTTCGGGAGGACCCGGGTGGTCGTGCCGTGCGGAGATGGCCGCATGAAAGTTTTCAGCCTCATCCAGCAGGCGG

TGACCCGCTACCGGAAGGCCGTGGCCAAG - UNI20252 - - UNI29364 - GATCCAAACTACTGGATACAGGTGCATCGCTTGGAGCATGGAGA

TGGAGGGATTCTAGACCTGGATGACATCCTCTGTGACGTTGCTGATGACAAAGACAGA - UNI26820 - CTGGTAGCAGTATTTGATGAACAGGATC

CCCACCATGGAGGAGATGGTACCAGCGCCAGCTCCACGGGAACCCAGAGTCCAGAGATATTCGGCAGTGAGCTGGGCACCAACAATGTTTCTGCTTTTCA

GCCTTATCAAGCCACAAGTGAAATTGAGGTCACGCCTTCAGTTCTTCGGGCAA - UNI3236 - - UNI11035 - - UNI26820 - ATATGCCT

CTTCATGTCCGCCGGAGCAGCGACCCAGCTTTAACTGGCCTTTCCACTTCTGTCAGTGATAACAACTTTTCCTCAGAGGAGCCCTCCAGGAAAAACCCCA

CCCGCTGGTCCACGACAGCTGGCTTTCTCAAGCAGAACACCGCTGGAAGTCCCAAAACCTGCGACAGGAAG - UNI3236 - AAAGATGAAAACTACA

GAAGCCTTCCACGGGATCCCAGTAGCTGGTCCAACCAGTTCCAGCGAGACAACGCCCGCTCCTCCCTGAGCGCCAGCCACCCAATGGTAGACCGGTGGCT

GGAGAAGCAAGAACAG - UNI3227 - GATGAGGAAGGCACAGAAGAAGACAGCAGCCGAGTGGAGCCGGTTGGACATGCTGATACCGGATTGGAGAA

CATGCCCAACTTTTCCCTCGA TGATATGGTAAAGCTCGTACAAGTCCCCAACGATGGAGGGCCCCTGGGAATCCATGTAGTGCCTTTCAGTGCTCGAGG

CGGCAG AACATTGGGGTTGTTAGTGAAGCGGTTGGAGAAAGGCGGTAAGGCTGAGCAAGAAAACCTTTTCCATGAGAATGACTGCATTGTGAGGATTAA

CGATGGAGATCTTCGAAACAGAAGATTTGAGCA AGCACAACATATGTTCCGCCAAGCTATGCGTGCGCGTGTCATTTGGTTCCATGTGGTCCCTGCAGC

AAACAAGGAGCAATATGAACAACTGTCCCAACGCGAGAAGAACAACTACTCCCCAGGCCGCTTCAGCCCTGACAGCCACTGTGTGGCCAACAGGAGTGTG

GCCAACAATGCCCCTCAAGCATTGCCCAGAGCACCCAGACTGAGTCAGCCACCCGAGCAGCTGGATGCTCACCCCCGACTACCTCATAGTGCTCACGCCT

CAACCAAACCACCCGCAGCCCCGGCCTTGGCTCCACCCAGTGTGCTTAGTACCAACGTAGGCAGTGTGTACAACACGAAGAAAGTAGGCAAGAGGCTCAA

CATCCAGCTTAAGAAAG GTACAGAAGGACTGGGATTCAGCATCACCTCCCGGGACGTCACCATAGGTGGCTCAGCTCCCATTTATGTCAAGAATATCCT

TCCTCGAGGGGCTGCCATTCAGGATGGCAGACTCAAGGCAGGAGACCGGCTAATAGAG GTCAATGGAGTAGATTTAGCAGGCAAATCCCAGGAGGAAGT

TGTTTCCCTGTTGAGAAGCACCAAGATGGAGGGGACTGTGAGCCTTCTGGTCTTTCGTCAGGAAGAGGCTTTCCACCCAAGGGAAATG - UNI4915 -

 AATGCTGAACCAAGCCAGATGCAGACTCCAAAAGAAACG AAAGCTGAAGATGAGGACGTTGTTCTCACACCCGATGGTACCAGGGAGTTTCTGACTTT

TGAAGTTCCACTGAATGACTCAGGATCTGCAGGGCTTGGTGTCAGTGTCAAGGGGAACCGTTCCAAAGAGAACCACGCAGATTTGGGGATCTTCGTTAAA

TCCATTATCAATGGTGGAGCTGCATCTAAA GATGGAAGGCTGAGGGTAAATGACCAGCTGATAGCTGTGAATGGAGAATCTCTACTGGGCAAAGCCAAC

CAGGAAGCCATGGAGACTCTACGGAGGTCCATGTCCACCGAGGGCAACAAGCGTGGCATGATCCAGCTCATTGTGGCGAGGCGGATCAGCAGATGTAACG

AG CTGCGGTCTCCTGGGAGCCCTGCTGCACCTGAGCTGCCCATCGAGACAGAACTGGATGACCGAGAACGCAGGATCTCACACTCCCTCTACAGTGGGA

TCGAGGGGCTGGATGAGTCGCCCACCAGGAACGCAGCACTGAGCAGGATAATGG GTAAATGCCAGCTGTCCCCCACGGTGAACATGCCTCACGATGACA

CTGTCATGATTGAAGATGACAGGCTGCCTGTGCTCCCTCCTCACCTCTCTGACCAGTCCTCCTCCAGCTCCCATGATGACGTTGGATTCATAATGACAGA

AGCAGGCACGTGGGCCAAAGCTACCATCAGTGACTCAGCCGACTG CTCATTGAGTCCAGATGTTGATCCGGTTCTCGCTTTTCAACGGGAAGGATTTGG

ACGCCAGAGTATGTCAGAAAAACGCACAAAGCAATTTTCAGATGCCAGTCAATTGGATTTCGTTAAAACACGAAAATCAAAAAGCATGGATTTAG TAGC

TGACGAGACTAAACTCAATACAGTGGATGACCAGAGAGCAG GCTCTCCCAGTAGAGATGTGGGACCCTCCTTAGGTCTGAAGAAATCTAGCTCCTTAGA

AAGTCTGCAGACCGCTGTCGCCGAGGTGACGCTGAACGGGAACATTCCTTTCCACCGCCCTCGGCCACGAATCATCCGGGGAAGGGGCTGCAACGAAAGC

TTCAGAGCCGCCATTGACAAGTCCTACGACAAGCCCATGGTTGATGATGACGACGAAGGCATGGAGACCT TGGAAGAAGACACAGAGGAAAGCTCGAGG

TCAGGGAGGGAGTCCGTGTCCACGTCCAGCGATCAGCCTTCCTATTCTCTGGAGAGGCAAATGAATGGAGACCCAGAGAAAAGGGACAAGACAGAGAGGA

AAAAGGACAAAGCCGGAAAGGATAAGAAGAAAGACCGAGAGAAGGAGAAGGATAAACTGAAAGCCAAGAAGGGGATGCTGAAAGGCTTGGGGGACATGTT

CAG GTTTGGCAAACATCGAAAAGATGACAAGATGGAAAAAATGGGTCGAATAAAAATCCAGGATTCTTTCACCTCAGAAGAGGACAGGGTGCGGATGAA

GGAAGAACAGGAGAG - UNI896 - GATTCAAGCCAAAACTCGAGAGTTTAGGGAGCGGCAAGCCCGAGAGCGTGACTATGCAGAGATCCAAGATTTC

CATCGGACGTTTGGCTGTGATGACGAGTTGCTGTATGGGGGCATGTCATCCTATGAAGGCTGCTTGGCTCTCAATGCCAGACCCCAGAGCCCAAGAGAAG

GGCACCTGATGGACACTTTGTATGCCCAAGTAAAGAAACCTCGGAGCTCCAAACCTGGAGACAG - UNI6919 - CAATCGATCCACTCCTAGCAACC

ATGACCGGATACAGCGTCTACGGCAAGAGTTCCAGCAAGCCAAACAGGATGAGGATGTGGAAGACCGGCGCCGTACCTACAGCTTTGAGCAATCTTGG -

 UNI27791 - TCCAGCTCGCGGCCGGCATCGCAGAGTGGTCGGCACTCGGTGTCCGTGGAGGTTCAAGTACAACGGCAGCGCCAGGAGGAGCGAGAGA

GCTTCCAGCAGGCCCAGCGCCAGTACAGCTCACTGCCAAG ACAAAGCAGGAAGAATGCCAGCTCCATATCACAGGATTCCTGGGAACAGAACTACGCCC

CTGGTGAAGGCTTCCAGAGTGCCAAGGAGAACCCCAGGTATTCCAGTTACCAGGGCTCAAGGAACGGCTATCTAGGCGGGCACGGCTTTAATGCCAGGGT

CATGCTGGAGACCCAGGAGCTTCTCCGACAGGAACAGAGGCGGAAAGAGCAGCAGCTGAAGAAGCAGCCTCCAGCTGATGGAGTCAGAGGGCCCTTCCGG

CAAGATGTGCCCCCTTCTCCATCTCAGGTGGCTAGGCTGAACAGACTGCAGACACCGGAGAAAGGGCGGCCCTTCTACTCCTGAGCTCAAAGAAGGATGG

CAGCATTTTGTGTCATGCAATAAAGGACATTTACCCATGA
Translation
MKVTVCFGRTRVVVPCGDGRMKVFSLIQQAVTRYRKAVAK - UNI20252 - - UNI29364 - DPNYWIQVHRLEHGDGGILDLDDILCDVADDKD

R - UNI26820 - LVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFQPYQATSEIEVTPSVLRAN - UNI3236 - - UNI11035 

- - UNI26820 - NMPLHVRRSSDPALTGLSTSVSDNNFSSEEPSRKNPTRWSTTAGFLKQNTAGSPKTCDRK - UNI3236 - KDENYRSLPRDP

SSWSNQFQRDNARSSLSASHPMVDRWLEKQEQ - UNI3227 - DEEGTEEDSSRVEPVGHADTGLENMPNFSLD DDMVKLVQVPNDGGPLGIHVVPF

SARGGR RTLGLLVKRLEKGGKAEQENLFHENDCIVRINDGDLRNRRFEQ QAQHMFRQAMRARVIWFHVVPAANKEQYEQLSQREKNNYSPGRFSPDSH

CVANRSVANNAPQALPRAPRLSQPPEQLDAHPRLPHSAHASTKPPAAPALAPPSVLSTNVGSVYNTKKVGKRLNIQLKKG GTEGLGFSITSRDVTIGGS

APIYVKNILPRGAAIQDGRLKAGDRLIE VNGVDLAGKSQEEVVSLLRSTKMEGTVSLLVFRQEEAFHPREM - UNI4915 - NAEPSQMQTPKET K

AEDEDVVLTPDGTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAASK DGRLRVNDQLIAVNGESLLGKANQEAMETLRRSMSTE

GNKRGMIQLIVARRISRCNE LRSPGSPAAPELPIETELDDRERRISHSLYSGIEGLDESPTRNAALSRIMG GKCQLSPTVNMPHDDTVMIEDDRLPVL

PPHLSDQSSSSSHDDVGFIMTEAGTWAKATISDSADC CSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDASQLDFVKTRKSKSMDLV VADETKLNTV

DDQRAG GSPSRDVGPSLGLKKSSSLESLQTAVAEVTLNGNIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPMVDDDDEGMETL LEEDTEESSRSGRES

VSTSSDQPSYSLERQMNGDPEKRDKTERKKDKAGKDKKKDREKEKDKLKAKKGMLKGLGDMFR RFGKHRKDDKMEKMGRIKIQDSFTSEEDRVRMKEEQ

ER - UNI896 - RIQAKTREFRERQARERDYAEIQDFHRTFGCDDELLYGGMSSYEGCLALNARPQSPREGHLMDTLYAQVKKPRSSKPGDS - UNI

6919 - SNRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQSW - UNI27791 - SSSRPASQSGRHSVSVEVQVQRQRQEERESFQQAQRQY

SSLPR RQSRKNASSISQDSWEQNYAPGEGFQSAKENPRYSSYQGSRNGYLGGHGFNARVMLETQELLRQEQRRKEQQLKKQPPADGVRGPFRQDVPPSP

SQVARLNRLQTPEKGRPFYS
Transcript ENSMUST00000079777
Sequence
CTGCTCGCGCCTCTAGCCGCCGGCGCGCCGGCGCAGCGGCCCCACCGCGCCCTGCGTACAGTCTCCCGGCCCAGCGCCGCTCCGGCCACGGACAGCGAGG

GACGGCGGCATGAAAGTGACCGTGTGCTTCGGGAGGACCCGGGTGGTCGTGCCGTGCGGAGATGGCCGCATGAAAGTTTTCAGCCTCATCCAGCAGGCGG

TGACCCGCTACCGGAAGGCCGTGGCCAAG - UNI20252 - - UNI29364 - GATCCAAACTACTGGATACAGGTGCATCGCTTGGAGCATGGAGA

TGGAGGGATTCTAGACCTGGATGACATCCTCTGTGACGTTGCTGATGACAAAGACAGA - UNI26820 - CTGGTAGCAGTATTTGATGAACAGGATC

CCCACCATGGAGGAGATGGTACCAGCGCCAGCTCCACGGGAACCCAGAGTCCAGAGATATTCGGCAGTGAGCTGGGCACCAACAATGTTTCTGCTTTTCA

GCCTTATCAAGCCACAAGTGAAATTGAGGTCACGCCTTCAGTTCTTCGGGCAA - UNI3236 - - UNI11035 - - UNI26820 - ATATGCCT

CTTCATGTCCGCCGGAGCAGCGACCCAGCTTTAACTGGCCTTTCCACTTCTGTCAGTGATAACAACTTTTCCTCAGAGGAGCCCTCCAGGAAAAACCCCA

CCCGCTGGTCCACGACAGCTGGCTTTCTCAAGCAGAACACCGCTGGAAGTCCCAAAACCTGCGACAGGAAG - UNI3236 - AAAGATGAAAACTACA

GAAGCCTTCCACGGGATCCCAGTAGCTGGTCCAACCAGTTCCAGCGAGACAACGCCCGCTCCTCCCTGAGCGCCAGCCACCCAATGGTAGACCGGTGGCT

GGAGAAGCAAGAACAG - UNI3227 - GATGAGGAAGGCACAGAAGAAGACAGCAGCCGAGTGGAGCCGGTTGGACATGCTGATACCGGATTGGAGAA

CATGCCCAACTTTTCCCTCGA TGATATGGTAAAGCTCGTACAAGTCCCCAACGATGGAGGGCCCCTGGGAATCCATGTAGTGCCTTTCAGTGCTCGAGG

CGGCAG AACATTGGGGTTGTTAGTGAAGCGGTTGGAGAAAGGCGGTAAGGCTGAGCAAGAAAACCTTTTCCATGAGAATGACTGCATTGTGAGGATTAA

CGATGGAGATCTTCGAAACAGAAGATTTGAGCA AGCACAACATATGTTCCGCCAAGCTATGCGTGCGCGTGTCATTTGGTTCCATGTGGTCCCTGCAGC

AAACAAGGAGCAATATGAACAACTGTCCCAACGCGAGAAGAACAACTACTCCCCAGGCCGCTTCAGCCCTGACAGCCACTGTGTGGCCAACAGGAGTGTG

GCCAACAATGCCCCTCAAGCATTGCCCAGAGCACCCAGACTGAGTCAGCCACCCGAGCAGCTGGATGCTCACCCCCGACTACCTCATAGTGCTCACGCCT

CAACCAAACCACCCGCAGCCCCGGCCTTGGCTCCACCCAGTGTGCTTAGTACCAACGTAGGCAGTGTGTACAACACGAAGAAAGTAGGCAAGAGGCTCAA

CATCCAGCTTAAGAAAG GTACAGAAGGACTGGGATTCAGCATCACCTCCCGGGACGTCACCATAGGTGGCTCAGCTCCCATTTATGTCAAGAATATCCT

TCCTCGAGGGGCTGCCATTCAGGATGGCAGACTCAAGGCAGGAGACCGGCTAATAGAG GTCAATGGAGTAGATTTAGCAGGCAAATCCCAGGAGGAAGT

TGTTTCCCTGTTGAGAAGCACCAAGATGGAGGGGACTGTGAGCCTTCTGGTCTTTCGTCAGGAAGAGGCTTTCCACCCAAGGGAAATG - UNI4915 -

 AATGCTGAACCAAGCCAGATGCAGACTCCAAAAGAAACG AAAGCTGAAGATGAGGACGTTGTTCTCACACCCGATGGTACCAGGGAGTTTCTGACTTT

TGAAGTTCCACTGAATGACTCAGGATCTGCAGGGCTTGGTGTCAGTGTCAAGGGGAACCGTTCCAAAGAGAACCACGCAGATTTGGGGATCTTCGTTAAA

TCCATTATCAATGGTGGAGCTGCATCTAAA GATGGAAGGCTGAGGGTAAATGACCAGCTGATAGCTGTGAATGGAGAATCTCTACTGGGCAAAGCCAAC

CAGGAAGCCATGGAGACTCTACGGAGGTCCATGTCCACCGAGGGCAACAAGCGTGGCATGATCCAGCTCATTGTGGCGAGGCGGATCAGCAGATGTAACG

AG CTGCGGTCTCCTGGGAGCCCTGCTGCACCTGAGCTGCCCATCGAGACAGAACTGGATGACCGAGAACGCAGGATCTCACACTCCCTCTACAGTGGGA

TCGAGGGGCTGGATGAGTCGCCCACCAGGAACGCAGCACTGAGCAGGATAATGG GTAAATGCCAGCTGTCCCCCACGGTGAACATGCCTCACGATGACA

CTGTCATGATTGAAGATGACAGGCTGCCTGTGCTCCCTCCTCACCTCTCTGACCAGTCCTCCTCCAGCTCCCATGATGACGTTGGATTCATAATGACAGA

AGCAGGCACGTGGGCCAAAGCTACCATCAGTGACTCAGCCGACTG CTCATTGAGTCCAGATGTTGATCCGGTTCTCGCTTTTCAACGGGAAGGATTTGG

ACGCCAGAGTATGTCAGAAAAACGCACAAAGCAATTTTCAGATGCCAGTCAATTGGATTTCGTTAAAACACGAAAATCAAAAAGCATGGATTTAGGTA T

AGCTGACGAGACTAAACTCAATACAGTGGATGACCAGAGAGCAG GCTCTCCCAGTAGAGATGTGGGACCCTCCTTAGGTCTGAAGAAATCTAGCTCCTT

AGAAAGTCTGCAGACCGCTGTCGCCGAGGTGACGCTGAACGGGAACATTCCTTTCCACCGCCCTCGGCCACGAATCATCCGGGGAAGGGGCTGCAACGAA

AGCTTCAGAGCCGCCATTGACAAGTCCTACGACAAGCCCATGGTTGATGATGACGACGAAGGCATGGAGACCT TGGAAGAAGACACAGAGGAAAGCTCG

AGGTCAGGGAGGGAGTCCGTGTCCACGTCCAGCGATCAGCCTTCCTATTCTCTGGAGAGGCAAATGAATGGAGACCCAGAGAAAAGGGACAAGACAGAGA

GGAAAAAGGACAAAGCCGGAAAGGATAAGAAGAAAGACCGAGAGAAGGAGAAGGATAAACTGAAAGCCAAGAAGGGGATGCTGAAAGGCTTGGGGGACAT

GTTCAG CCTGGCCAAACTGAAGCCGGAGAAGAGATGA
Translation
 - UNI20252 - - UNI29364 -  - UNI26820 -  - UNI3236 - - UNI11035 - - UNI26820 - MPLHVRRSSDPALTGLSTSV

SDNNFSSEEPSRKNPTRWSTTAGFLKQNTAGSPKTCDRK - UNI3236 - KDENYRSLPRDPSSWSNQFQRDNARSSLSASHPMVDRWLEKQEQ - U

NI3227 - DEEGTEEDSSRVEPVGHADTGLENMPNFSLD DDMVKLVQVPNDGGPLGIHVVPFSARGGR RTLGLLVKRLEKGGKAEQENLFHENDCIV

RINDGDLRNRRFEQ QAQHMFRQAMRARVIWFHVVPAANKEQYEQLSQREKNNYSPGRFSPDSHCVANRSVANNAPQALPRAPRLSQPPEQLDAHPRLPH

SAHASTKPPAAPALAPPSVLSTNVGSVYNTKKVGKRLNIQLKKG GTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIE VNGVDLA

GKSQEEVVSLLRSTKMEGTVSLLVFRQEEAFHPREM - UNI4915 - NAEPSQMQTPKET KAEDEDVVLTPDGTREFLTFEVPLNDSGSAGLGVSVK

GNRSKENHADLGIFVKSIINGGAASK DGRLRVNDQLIAVNGESLLGKANQEAMETLRRSMSTEGNKRGMIQLIVARRISRCNE LRSPGSPAAPELPIE

TELDDRERRISHSLYSGIEGLDESPTRNAALSRIMG GKCQLSPTVNMPHDDTVMIEDDRLPVLPPHLSDQSSSSSHDDVGFIMTEAGTWAKATISDSAD

C CSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDASQLDFVKTRKSKSMDLGI IADETKLNTVDDQRAG GSPSRDVGPSLGLKKSSSLESLQTAVAE

VTLNGNIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPMVDDDDEGMETL LEEDTEESSRSGRESVSTSSDQPSYSLERQMNGDPEKRDKTERKKDKAGK

DKKKDREKEKDKLKAKKGMLKGLGDMFS SLAKLKPEKR
Transcript ENSMUST00000108752
Sequence
TCTTCTCTTTGCCTGTGTAGATATGCCTCTTCATGTCCGCCGGAGCAGCGACCCAGCTTTAACTGGCCTTTCCACTTCTGTCAGTGATAACAACTTTTCC

TCAGAGGAGCCCTCCAGGAAAAACCCCACCCGCTGGTCCACGACAGCTGGCTTTCTCAAGCAGAACACCGCTGGAAGTCCCAAAACCTGCGACAGGAAG 

- UNI3236 - AAAGATGAAAACTACAGAAGCCTTCCACGGGATCCCAGTAGCTGGTCCAACCAGTTCCAGCGAGACAACGCCCGCTCCTCCCTGAGCG

CCAGCCACCCAATGGTAGACCGGTGGCTGGAGAAGCAAGAACAG - UNI3227 - GATGAGGAAGGCACAGAAGAAGACAGCAGCCGAGTGGAGCCGG

TTGGACATGCTGATACCGGATTGGAGAACATGCCCAACTTTTCCCTCGA TGATATGGTAAAGCTCGTACAAGTCCCCAACGATGGAGGGCCCCTGGGAA

TCCATGTAGTGCCTTTCAGTGCTCGAGGCGGCAG AACATTGGGGTTGTTAGTGAAGCGGTTGGAGAAAGGCGGTAAGGCTGAGCAAGAAAACCTTTTCC

ATGAGAATGACTGCATTGTGAGGATTAACGATGGAGATCTTCGAAACAGAAGATTTGAGCA AGCACAACATATGTTCCGCCAAGCTATGCGTGCGCGTG

TCATTTGGTTCCATGTGGTCCCTGCAGCAAACAAGGAGCAATATGAACAACTGTCCCAACGCGAGAAGAACAACTACTCCCCAGGCCGCTTCAGCCCTGA

CAGCCACTGTGTGGCCAACAGGAGTGTGGCCAACAATGCCCCTCAAGCATTGCCCAGAGCACCCAGACTGAGTCAGCCACCCGAGCAGCTGGATGCTCAC

CCCCGACTACCTCATAGTGCTCACGCCTCAACCAAACCACCCGCAGCCCCGGCCTTGGCTCCACCCAGTGTGCTTAGTACCAACGTAGGCAGTGTGTACA

ACACGAAGAAAGTAGGCAAGAGGCTCAACATCCAGCTTAAGAAAG GTACAGAAGGACTGGGATTCAGCATCACCTCCCGGGACGTCACCATAGGTGGCT

CAGCTCCCATTTATGTCAAGAATATCCTTCCTCGAGGGGCTGCCATTCAGGATGGCAGACTCAAGGCAGGAGACCGGCTAATAGAG GTCAATGGAGTAG

ATTTAGCAGGCAAATCCCAGGAGGAAGTTGTTTCCCTGTTGAGAAGCACCAAGATGGAGGGGACTGTGAGCCTTCTGGTCTTTCGTCAGGAAGAGGCTTT

CCACCCAAGGGAAATG - UNI4915 - AATGCTGAACCAAGCCAGATGCAGACTCCAAAAGAAACG AAAGCTGAAGATGAGGACGTTGTTCTCACAC

CCGATGGTACCAGGGAGTTTCTGACTTTTGAAGTTCCACTGAATGACTCAGGATCTGCAGGGCTTGGTGTCAGTGTCAAGGGGAACCGTTCCAAAGAGAA

CCACGCAGATTTGGGGATCTTCGTTAAATCCATTATCAATGGTGGAGCTGCATCTAAA GATGGAAGGCTGAGGGTAAATGACCAGCTGATAGCTGTGAA

TGGAGAATCTCTACTGGGCAAAGCCAACCAGGAAGCCATGGAGACTCTACGGAGGTCCATGTCCACCGAGGGCAACAAGCGTGGCATGATCCAGCTCATT

GTGGCGAGGCGGATCAGCAGATGTAACGAG CTGCGGTCTCCTGGGAGCCCTGCTGCACCTGAGCTGCCCATCGAGACAGAACTGGATGACCGAGAACGC

AGGATCTCACACTCCCTCTACAGTGGGATCGAGGGGCTGGATGAGTCGCCCACCAGGAACGCAGCACTGAGCAGGATAATGG GAACATAGGATTTGCCA

TACTGATCAGCCCATTGGTACACCAGCTCCTGTAACCAGCATCCTGCCTCCAATCCCTGGTTCTTCAGAGGAAGGCGAAAACCTAACACTCAAACACATA

CCAGCCCCCACCCAGATCTTTCACCTAGTGACTTGTTGAAATGTGTAAAATGGGTTGAGGAGTACGTCATTTTTTTTCCATATTTTGTCACCCGGTTTTG

TTAGTCCTGACTTGTTAGTCTTTTTCAGCGGGTAATCTGGGAGGCAGTGTTTTCTCTCCCTCTGCTAAGTATGTAATGAACCCTCCTACTCATGGTGACT

CCCCTTGCAGGCTGGTTCCTCCTGCTATGCTTGGTTTTGCTCTGCACATGTCCTGGGACTTATGGACTGGGGATGACATCATACTCAGTAGGCCAAGATT

TTATAGTAGTTTATCTTTAGGGGAAGGGATTGAATCCAGGGTTTCTCGATGACTTCATTTGTCCATGTCCTTAAGACATGTTTTATATGCTGTACTGGAA

ACTAGGTAAGGCCCATGTGGCTTTACCTAGGGAAATATATAGACTTAATTTATCTTGCTGTTTACAAACTTCAAAGTTATTATACTTTTTCCATCCTTAT

CCTAATATGGCTGGCTGTAAAAAATGCATGCTACTGGTGAAGTTAGATAGCACTGAGATTAGAAATCCTGCCACTAGGAGGAAAACAGTACTTAATATCA

GTATGTCTTTTCTCCATCAGCCTGCTGATTTATACTGTGTCAGGTGCATAGACATTTCTCAGCGAGGTCCTACCTGGCTAGTTCATTGATTGTCTCCTGC

GTCTTTAAGCTCACTCCCTATAGACCAATGTTTCATATGATAGAAAAAGAAGTGTTGAAATTCCTTATGATGACACAAAGAAGTGATTAATTTTGTGTGA

GCAAGGCAATTTTTCACAAAGAGTACTTTGTGCATGCAACCAAAAGAATTTTAAAGGCTTGTGATAATTTTTGAAAGGGTGTACATCCCAGGAGAGAGAC

TTCAAAAAAAAAATATACATCCAAAATGAAACATCTTTCCTAATTGGAAGGATGTCAGATGTCTTCAGTCACACTTTCTCACTTAGCGGATAAGAGAGAT

GTGTCCTAAAACCCCGTGATGATTTTGCTTTGTTTTGGTTTTGACTGTTCCCTCTTGGGGAATGCCAAGCTCTCCCGGTAAGTTTTAATGACACCACATT

GACTGGAAGACTCTGAGGTATCACCATAGCCTGGTCCCCTGGTCCCCATGTGATGAGATCCTTAAGACATTTCCCCAACACTCACATCACAGTCTTCGTT

CTGCTCTGGTGTCGGAGTTACAGAACCCTGGCCAGTGACTTGCCTGAAATGGCATATTGTTCCTGAACCACAGTTTGAATGTGTGGTTCTCTGGGCAGTA

GGTGCCTCTTTAGTAACAGCCAGTTTATCTCTATCACTTTGAATGGATCACTCAGAAATGTGACCAAAGGCCAAACCTAACCATACTCCTCTCTTTTTGG

TTGGATTCCCACTGCCATTAATATTAGAACATGAGTCCTATTTTGTATTAGGAAGCAACTCATAAGGGCTGGGAATATAGCTAAGAGTACTTGCCTAGCA

TTTACAGCGCCCTGCTTCCAGATCCACAAAATTAGGTTAAGTAAGTT
Translation
MPLHVRRSSDPALTGLSTSVSDNNFSSEEPSRKNPTRWSTTAGFLKQNTAGSPKTCDRK - UNI3236 - KDENYRSLPRDPSSWSNQFQRDNARSSL

SASHPMVDRWLEKQEQ - UNI3227 - DEEGTEEDSSRVEPVGHADTGLENMPNFSLD DDMVKLVQVPNDGGPLGIHVVPFSARGGR RTLGLLVKR

LEKGGKAEQENLFHENDCIVRINDGDLRNRRFEQ QAQHMFRQAMRARVIWFHVVPAANKEQYEQLSQREKNNYSPGRFSPDSHCVANRSVANNAPQALP

RAPRLSQPPEQLDAHPRLPHSAHASTKPPAAPALAPPSVLSTNVGSVYNTKKVGKRLNIQLKKG GTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQ

DGRLKAGDRLIE VNGVDLAGKSQEEVVSLLRSTKMEGTVSLLVFRQEEAFHPREM - UNI4915 - NAEPSQMQTPKET KAEDEDVVLTPDGTREF

LTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAASK DGRLRVNDQLIAVNGESLLGKANQEAMETLRRSMSTEGNKRGMIQLIVARRIS

RCNE LRSPGSPAAPELPIETELDDRERRISHSLYSGIEGLDESPTRNAALSRIMG GT

For any suggestions or comments, please send an email to unitrap@crg.es