Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025862 (Stag2)
Chromosomal location
Chr X: 39502589 - 39630352 (+)
Description
stromal antigen 2 Gene [Source:MGI (curated);Acc:Stag2-002]
RefSeq_dna
NM_001077712 NM_021465 
RefSeq_peptide
NP_067440.3 NP_001071180.1 
UniGene
Mm.402019 Mm.470372 Mm.290422 
MGI
MGI:1098583 
Uniprot/SWISSPROT
O35638 
Uniprot/SPTREMBL
A2AFF3 A2AFF5 Q3TG33 Q3UQG8 Q8BSB5 A2AFF6 
Human Ortholog
ENSG00000101972 (STAG2)
Omim not available
UniTrap UNI18774
Vector Insertion
Chr X: 39504012 - 39555031
Public Clones (sanger) IST11038E5 (tigm)
Private Clones OST414524 (lexicon) OST345597 (lexicon) OST316653 (lexicon) OST235423 (lexicon)
OST101319 (lexicon) OST59809 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4824
Vector Insertion
Chr X: 39622685 - 39624421
Public Clones AM0770 (sanger)
Private Clones OST184924 (lexicon)
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000069619
Sequence
GAGGGAACAACATTCATGTGACGGGCCCCTCGGCTTCTCTCCCCCGCCCCATCATCTCCAGCGCGTGGTGGGGGAACTGCTTGGGCAAAGCGGTTGGCAT

CGATCTCTCCATCCTTCCCGAGGCCCCGACTTCG - UNI18774 - GAACTGTCTTTCTTAGAGGAAGCACACTGTCATTTTACTCACATAAATATAT

GAATATATTTCTGACATTGGGGTGATCCAGAAGATGATAAAGAAATGATAGCAGCTCCAGAAATACCAACTGATTTTAATCTACTGCA GGAGTCAGAGA

CACACTTTTCTTCTGACACAGATTTTGAAGACATTGAAGGAAAAAATCAGAAGCAAGGCAAAGGCAAA ACTTGTAAAAAAGGCAAAAAGGGTCCAGCAG

AAAAGGGTAAAAGTGGAAATGGAGGAGGAAAACCTCCTTCTGGCTCAAACCGAATGAACGGTCATCATCAACAGAATGGAGTTGAAAACATGATGTTGTT

CGAAGTTGTTAAAATGGGCAAGAGTGCTATGCAG TCGGTGGTAGATGACTGGATCGAGTCCTACAAGCATGACCGGGACATAGCGCTTCTTGACCTTAT

CAATTTCTTTATTCAGTGCTCAGGCTGCAAAG GAGTCGTCACAGCAGAGATGTTCAGACATATGCAGAACTCTGAGATAATTCGAAAAATGACAGAAGA

ATTTGACGAG GATAGTGGGGATTACCCACTTACCATGGCTGGTCCTCAGTGGAAGAAGTTCAAGTCCAGCTTCTGTGAGTTCATTGGTGTGTTAGTACG

GCAGTGTCAATACAGTATCATATATGATGAGTACATGATGGATACTGTCATTTCACTTCTTACTGGATTGTCTGACTCCCAAGTCAGAGCATTTCGACAT

ACAAGCACCCTGGCAG CTATGAAGTTGATGACTGCTTTGGTAAATGTGGCACTAAATCTTAGCATTAATATGGATAACACACAAAGACAGTACGAGGCA

GAACGGAATAAAATGATTGGAAAACGAGCTAACGAAAGGCTAGAACTCCTGTTACAAAAGCGTAAAGAG CTTCAGGAAAATCAAGATGAGATAGAAAAT

ATGATGAATGCAATATTTAAAGGAGTGTTTGTACATAGATACAG GGATGCAATAGCTGAAATCAGAGCTATATGCATTGAAGAGATTGGCATTTGGATG

AAGATGTATAGTGATGCCTTCCTTAATGACAGCTATTTAAAATATGTTGGTTGGACTATGCATGATAAG CAAGGTGAAGTCAGACTCAAATGTCTTACT

GCTTTACAAGGGCTTTACTATAACAAAGAACTTAATTCCAAACTGGAACTCTTTACCAGTCGATTCAAG GATAGAATTGTGTCTATGACCCTTGACAAA

GAATATGATGTTGCAGTACAAGCAATAAAGTTACTCACTCTTGTTTTACA GAGTAGTGAAGAAGTTCTAACTGCAGAAGATTGTGAAAATGTCTATCAT

CTGGTTTATTCAGCTCACCGGCCAGTAGCAGTTGCAGCTGGAGAATTTCTCTACAAAAA GCTCTTCAGCCGCAGAGACCCAGAAGAGGATGGGCTGATG

AAAAGAAGGGGAAGGCAAGGCCCGAATGCCAACCTTGTGAAGACTTTGGTGTTTTTCTTTTTGGAAAGTGAG TTACACGAGCATGCAGCTTACCTTGTG

GACAGCATGTGGGATTGTGCTACTGAGCTCCTGAAAGACTGGGAATGTATGAATAGCTTGTTATTAGAAGAGCCTCTTAGTGGAGAGGAAG CTCTAACA

GACAGACAAGAGAGTGCTTTGATTGAAATAATGCTTTGTACTATTAGACAAGCAGCTGAATGTCATCCTCCCGTGGGAAGAGGGACAGGAAAAAGG GTG

CTGACAGCAAAGGAGAAGAAGACACAGTTGGATGACAGAACAAGAATCACTGAGCTGTTTGCTGTGGCCCTTCCGCAGTTATTAGCTAAA TACTCTGTA

GATGCAGAAAAGGTGACCAATTTGTTGCAGTTACCTCAGTACTTTGATTTGGAGATATACACCACTGGACGATTAGAAAAG CATTTGGATGCCTTATTG

CGCCAGATCCGAAATATTGTAGAGAAGCACACAGACACAGATGTTTTGGAAGCATGTTCTAAAACTTACCATGCATTATGTAACGAAGAGTTCACCATCT

TCAACAGAGTAGATATTTCAAGAAGTCAGCTGATTGATGAACTGGCAGATAAATTTAACCGGCTTCTTGAAGATTTTCTGCAAGAG GGAGAAGAACCTG

ATGAAGATGACGCATATCAGGTATTGTCAACATTGAAGAGGATCACTGCTTTTCATAA TGCTCATGATCTTTCAAAGTGGGATTTGTTCGCTTGTAATT

ACAAACTCTTGAAAACCGGAATCGAAAATGGAGATATGCCTGAGCAG ATTGTTATTCACGCACTGCAGTGTGCTCACTATGTAATCCTTTGGCAGCTTG

CTAAGATCACTGAAAGCACGTCTACAAAG GAGGACTTACTGCGCTTAAAGAAACAGATGAGGGTATTTTGCCAGATATGTCAGCATTACTTGACCAACG

TGAATACTACTGTTAAAGAACAG GCCTTCACTATTCTGTGTGACATTTTGATGATCTTCAGTCACCAGATTATGTCTGGAGGGCGTGACATGTTAGAGC

CATTAGTTTATACTCCTGATTCTTCATTGCAGTCTGAGTTGCTCAGCTTTATTTTGGATCATGTCTTCATTGAACAGGATGATGATAGTAATAGTGCAG 

ATGGTCAGCAAGAGGATGAAGCCAGCAAAATTGAAGCTTTGCACAAGAGGAGAAATTTACTTGCAGCATTTTGTAAGCTAATTGTATATACCGTGGTGGA

GATGAACACAGCTGCAGATATCTTCAAGCAGTATATGAAG TATTATAATGATTATGGCGATATCATCAAAGAAACAATGAGTAAAACAAGGCAGATTGA

CAAAATTCAGTGTGCTAAGACCCTTATTCTCAGTTTGCAGCAG CTTTTTAATGAGATGATACAAGAGAATGGCTATAATTTTGATAGATCATCCTCAAC

ATTTAGTGGCATAAAAGAACTTGCTCGGCGTTTTGCTTTAACTTTTGGACTTGATCAATTGAAAACCAGAGAAGCCATTGCCATGCTCCACAA AGATGG

TATAGAATTTGCTTTTAAGGAGCCTAATCCACAAGGGGAGAGCCATCCACCTTTAAACTTGGCATTTCTTGATATTCTCAGTGAATTTTCTTCTAAACTG

CTCCGACAGGATAAAAGAACAGT GTATGTTTATTTGGAAAAGTTCATGACCTTTCAGATGTCACTCCGAAGAGAAGATGTATGGCTTCCTCTGATGTCT

TACCGAAATTCTTTGCTAGCTGGTGGTGATGATGATACTATGTCAGTCATTAGTGGAATGAGCAGTCGGGGATCAACTGTACGGAGTAAAAAATCAAAAC

CATCTACAGGAAAGCGGAAAGTGGTTGAAGGCATGCAACTAGCACTCC CTGAAGAAAGCAGTAGCAGTGACAGTATGTGGTTGAGCAGAGAGCAAACAC

TGCACACCCCTGTCATGATGCAGACACCACAGCTCACCTCCACTATTATGAGAGAACCGAAAAGGTTACGGCCTGAAGATAGCTTCATGAGTGTCTATCC

GATGCAGGCAGAACACCATCAAACGCCTCTGGATTATAA TCGGCGTGGTACAAGCCTAATGGAAGATGATGAAGAGCCAATTGTTGAAGATGTTATGAT

GTCCTCAGAAGGAAGGATTGAGGATCTTAATGAGGGAATGGACTTTGACACCATGGATATAGACTTG - UNI4824 - CCACCATCAAAGAATAGAAG

AGAGAGAACAGAACTGAAGCCCGATTTCTTTGATCCAGCTTCAATTATGGATGAATCA GTTCTTGGGGTGTCAATGTTTTAATCCCAGTACACATTTAA

ATCTGTGGTGAAGTCGTTTTCTAAGTGGAAGAGGAAATTTGAAAATAAAGTGTGGTAGATACAGTGAAATTCTGTACAGATTTTTCTCTAAGGAGAATAT

AACATGCTTATGCTTACCAAGATGAAGTGCATTGAGGGGCAGTTTTGTTTGCCTGAAAAAATAAAGGACAAGTAAACAATTTGATGATAAGCTACAGTTT

TTCTTAGAAAGTAAATATTTTATTTATGCGCTGTTAGTTGGCTTTTAAAGGAATTATTTCATGCTTTTTTAAAAAATATAACAATCTGAAGAAGTATTTG

GTACAGATAAGAATCTTCTCACATTTATTTACTGGTTGTACTAAATAATGATGACCTCTGCTGGATTTCTGTTTACATCCACGAAACAAAAGTTAAGGAT

GGATTTATTCCCCGACCCTGAAATTGTAGGATAGAATTGTTTTTAGCATTCTAAATTTAAATGCTTAAAACATCAATCAACAAAACTTTGTTTTAAATGT

TGTAATTGTGGAAAAAAAGTTAAACTTATAAGCAGAACTTTTACAATTTTTTCATCTAAAATGTATTTTAAGATATTTTTAAAATCCAAGAGCTTCTGTA

TACTTTTCAGAAATATCCAGATGCAGTGAACTGCCAGAAGGTAACCAGTCTTGAACATGCTTATCCCATAGCAGCCCTGAACGTTTGCTTGTCCTTTAAG

ATAAAAATGTAACGTTGTGATATTCCTTCCAGTAGTGCCACTGTATTTTGTCTCCAAATAAAAGAAGCTTATTGTAGTATGTTTGCAGAAAATTTAAACA

AAAATTATACAGCTTATTAGAGTGTGGGAATAGGGATCTAAATTTTAAATAAAATTATATATATATATAAATTGGTGCTGATTTTATAATTGCGCAGTTT

GTTTAGTTTTTTCTTACTTTTAAATTCCAACTTAAAATTATGAGGTTTCAGAAATATATTGAAAGTTTAACAATGTTTAAAAATAGAAAAGCATGACTGT

TCATGCTTTAAAATGATTTTTAAATTTGTATTTTATATTGTTTTATCTATCTGTCTTTGCAAGCAGTCTTCAGGTTAAAGATACTTCTAACAGGTTACAG

TACATTTCCTCTGTATGTAAATTAGATGGGATAATAGAATTCATAACCCATAATATTCTTTGAAAGCTAAGCTTTAAACTTCATTTTATGTCCTTTCACA

AGTGAATTAGTTTAAAACAGAAAGTGGCCACTTGCCATTTTGACATCGACTCATTTTGCGAGGCTTAGGCAGCTAGACATCGTTTAAAACAAAATATTAA

CTTATATTACATGTATATCTATCTTTTGTCAGTCGTCTCTCAGTTCTTGAGGTATATTATTTTAATCATTCCATGCCTTAATATGCTTGCAATACAAGAA

TATCTTCAGATGTGTGAATACCAAAAGGTTTCTGGTTTTTCGAGTCAGGAAATCAACAAGCATTGGGCTGTGGTAGCCAAAAAACCATAGGTTAAATGAA

CGACCACAACATACATTTGTTTTATTAATTAATGGTTAACAAATAAAACCAGACTTGTCTAACATACTTTCCATCAACAACCATTGTTACGTGCAAACAT

ATTGCATATGTTCCTTCACACACCACTGCATTTCCTAGAACTGCTGAGAGGACTGTATATATGATTTGAAACCTAGGTTGATTTCTTTTCTCACTCTTGA

AAGGAGTATTTCTTTGTGAAAGCAGTTCTTCCAGCTTTGTTTTGAACCAGCTAAACTGTTTTCTATATTACTCTAACCTGTTGTCCTCCACATTCTATTG

TCCTAATTGTACTGTTTGCTGATTTGTATTTATGTCTTGAGACAGTAACTTTTTGAATAAAAATAAACCTAC
Translation
 - UNI18774 - MIAAPEIPTDFNLLQ QESETHFSSDTDFEDIEGKNQKQGKGK TCKKGKKGPAEKGKSGNGGGKPPSGSNRMNGHHQQNGVENMM

LFEVVKMGKSAMQ SVVDDWIESYKHDRDIALLDLINFFIQCSGCKG GVVTAEMFRHMQNSEIIRKMTEEFDE DSGDYPLTMAGPQWKKFKSSFCEFI

GVLVRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAA AMKLMTALVNVALNLSINMDNTQRQYEAERNKMIGKRANERLELLLQKRKE LQE

NQDEIENMMNAIFKGVFVHRYR RDAIAEIRAICIEEIGIWMKMYSDAFLNDSYLKYVGWTMHDK QGEVRLKCLTALQGLYYNKELNSKLELFTSRFK 

DRIVSMTLDKEYDVAVQAIKLLTLVLQ QSSEEVLTAEDCENVYHLVYSAHRPVAVAAGEFLYKK KLFSRRDPEEDGLMKRRGRQGPNANLVKTLVFFF

LESE LHEHAAYLVDSMWDCATELLKDWECMNSLLLEEPLSGEEA ALTDRQESALIEIMLCTIRQAAECHPPVGRGTGKR VLTAKEKKTQLDDRTRIT

ELFAVALPQLLAK YSVDAEKVTNLLQLPQYFDLEIYTTGRLEK HLDALLRQIRNIVEKHTDTDVLEACSKTYHALCNEEFTIFNRVDISRSQLIDELA

DKFNRLLEDFLQE GEEPDEDDAYQVLSTLKRITAFHN NAHDLSKWDLFACNYKLLKTGIENGDMPEQ IVIHALQCAHYVILWQLAKITESTSTK ED

LLRLKKQMRVFCQICQHYLTNVNTTVKEQ AFTILCDILMIFSHQIMSGGRDMLEPLVYTPDSSLQSELLSFILDHVFIEQDDDSNSAD DGQQEDEASK

IEALHKRRNLLAAFCKLIVYTVVEMNTAADIFKQYMK YYNDYGDIIKETMSKTRQIDKIQCAKTLILSLQQ LFNEMIQENGYNFDRSSSTFSGIKELA

RRFALTFGLDQLKTREAIAMLHK KDGIEFAFKEPNPQGESHPPLNLAFLDILSEFSSKLLRQDKRTV VYVYLEKFMTFQMSLRREDVWLPLMSYRNSL

LAGGDDDTMSVISGMSSRGSTVRSKKSKPSTGKRKVVEGMQLALP PEESSSSDSMWLSREQTLHTPVMMQTPQLTSTIMREPKRLRPEDSFMSVYPMQA

EHHQTPLDYN NRRGTSLMEDDEEPIVEDVMMSSEGRIEDLNEGMDFDTMDIDL - UNI4824 - PPSKNRRERTELKPDFFDPASIMDES VLGVSM

F
Transcript ENSMUST00000115072
Sequence
AAAAGAAAGGAAAAAAAATACAGAAAAAAGGGAAAAAAACAAAACAAAACAAAAAAAGCACCCCGCCGGATCCGACCGCCACTTTCAAACCCCCCCACGG

CTCTAGACCCGCGGGAGCTTCCGTCCCTCAGTAGAACTCAAGGGTGGAAAGAAGAGGAAGGGGGAAAAATCTTGTACCAGCCCAGGGGTGAAGAAGCCCC

CGGCCTGAGAAAGAAGGAAGGAGTGGGGGAGGCCAACAGTCTCCTTGCTGCCTCTGTAGACGCTGAGGGGGGAG - UNI18774 - GAACTGTCTTTC

TTAGAGGAAGCACACTGTCATTTTACTCACATAAATATATGAATATATTTCTGACATTGGGGTGATCCAGAAGATGATAAAGAAATGATAGCAGCTCCAG

AAATACCAACTGATTTTAATCTACTGCA GGAGTCAGAGACACACTTTTCTTCTGACACAGATTTTGAAGACATTGAAGGAAAAAATCAGAAGCAAGGCA

AAGGCAAA ACTTGTAAAAAAGGCAAAAAGGGTCCAGCAGAAAAGGGTAAAAGTGGAAATGGAGGAGGAAAACCTCCTTCTGGCTCAAACCGAATGAACG

GTCATCATCAACAGAATGGAGTTGAAAACATGATGTTGTTCGAAGTTGTTAAAATGGGCAAGAGTGCTATGCAG TCGGTGGTAGATGACTGGATCGAGT

CCTACAAGCATGACCGGGACATAGCGCTTCTTGACCTTATCAATTTCTTTATTCAGTGCTCAGGCTGCAAAG GAGTCGTCACAGCAGAGATGTTCAGAC

ATATGCAGAACTCTGAGATAATTCGAAAAATGACAGAAGAATTTGACGAG GATAGTGGGGATTACCCACTTACCATGGCTGGTCCTCAGTGGAAGAAGT

TCAAGTCCAGCTTCTGTGAGTTCATTGGTGTGTTAGTACGGCAGTGTCAATACAGTATCATATATGATGAGTACATGATGGATACTGTCATTTCACTTCT

TACTGGATTGTCTGACTCCCAAGTCAGAGCATTTCGACATACAAGCACCCTGGCAG CTATGAAGTTGATGACTGCTTTGGTAAATGTGGCACTAAATCT

TAGCATTAATATGGATAACACACAAAGACAGTACGAGGCAGAACGGAATAAAATGATTGGAAAACGAGCTAACGAAAGGCTAGAACTCCTGTTACAAAAG

CGTAAAGAG CTTCAGGAAAATCAAGATGAGATAGAAAATATGATGAATGCAATATTTAAAGGAGTGTTTGTACATAGATACAG GGATGCAATAGCTGA

AATCAGAGCTATATGCATTGAAGAGATTGGCATTTGGATGAAGATGTATAGTGATGCCTTCCTTAATGACAGCTATTTAAAATATGTTGGTTGGACTATG

CATGATAAG CAAGGTGAAGTCAGACTCAAATGTCTTACTGCTTTACAAGGGCTTTACTATAACAAAGAACTTAATTCCAAACTGGAACTCTTTACCAGT

CGATTCAAG GATAGAATTGTGTCTATGACCCTTGACAAAGAATATGATGTTGCAGTACAAGCAATAAAGTTACTCACTCTTGTTTTACA GAGTAGTGA

AGAAGTTCTAACTGCAGAAGATTGTGAAAATGTCTATCATCTGGTTTATTCAGCTCACCGGCCAGTAGCAGTTGCAGCTGGAGAATTTCTCTACAAAAA 

GCTCTTCAGCCGCAGAGACCCAGAAGAGGATGGGCTGATGAAAAGAAGGGGAAGGCAAGGCCCGAATGCCAACCTTGTGAAGACTTTGGTGTTTTTCTTT

TTGGAAAGTGAG TTACACGAGCATGCAGCTTACCTTGTGGACAGCATGTGGGATTGTGCTACTGAGCTCCTGAAAGACTGGGAATGTATGAATAGCTTG

TTATTAGAAGAGCCTCTTAGTGGAGAGGAAG CTCTAACAGACAGACAAGAGAGTGCTTTGATTGAAATAATGCTTTGTACTATTAGACAAGCAGCTGAA

TGTCATCCTCCCGTGGGAAGAGGGACAGGAAAAAGG GTGCTGACAGCAAAGGAGAAGAAGACACAGTTGGATGACAGAACAAGAATCACTGAGCTGTTT

GCTGTGGCCCTTCCGCAGTTATTAGCTAAA TACTCTGTAGATGCAGAAAAGGTGACCAATTTGTTGCAGTTACCTCAGTACTTTGATTTGGAGATATAC

ACCACTGGACGATTAGAAAAG CATTTGGATGCCTTATTGCGCCAGATCCGAAATATTGTAGAGAAGCACACAGACACAGATGTTTTGGAAGCATGTTCT

AAAACTTACCATGCATTATGTAACGAAGAGTTCACCATCTTCAACAGAGTAGATATTTCAAGAAGTCAGCTGATTGATGAACTGGCAGATAAATTTAACC

GGCTTCTTGAAGATTTTCTGCAAGAG GGAGAAGAACCTGATGAAGATGACGCATATCAGGTATTGTCAACATTGAAGAGGATCACTGCTTTTCATAA T

GCTCATGATCTTTCAAAGTGGGATTTGTTCGCTTGTAATTACAAACTCTTGAAAACCGGAATCGAAAATGGAGATATGCCTGAGCAG ATTGTTATTCAC

GCACTGCAGTGTGCTCACTATGTAATCCTTTGGCAGCTTGCTAAGATCACTGAAAGCACGTCTACAAAG GAGGACTTACTGCGCTTAAAGAAACAGATG

AGGGTATTTTGCCAGATATGTCAGCATTACTTGACCAACGTGAATACTACTGTTAAAGAACAG GCCTTCACTATTCTGTGTGACATTTTGATGATCTTC

AGTCACCAGATTATGTCTGGAGGGCGTGACATGTTAGAGCCATTAGTTTATACTCCTGATTCTTCATTGCAGTCTGAGTTGCTCAGCTTTATTTTGGATC

ATGTCTTCATTGAACAGGATGATGATAGTAATAGTGCAG ATGGTCAGCAAGAGGATGAAGCCAGCAAAATTGAAGCTTTGCACAAGAGGAGAAATTTAC

TTGCAGCATTTTGTAAGCTAATTGTATATACCGTGGTGGAGATGAACACAGCTGCAGATATCTTCAAGCAGTATATGAAG TATTATAATGATTATGGCG

ATATCATCAAAGAAACAATGAGTAAAACAAGGCAGATTGACAAAATTCAGTGTGCTAAGACCCTTATTCTCAGTTTGCAGCAG CTTTTTAATGAGATGA

TACAAGAGAATGGCTATAATTTTGATAGATCATCCTCAACATTTAGTGGCATAAAAGAACTTGCTCGGCGTTTTGCTTTAACTTTTGGACTTGATCAATT

GAAAACCAGAGAAGCCATTGCCATGCTCCACAA AGATGGTATAGAATTTGCTTTTAAGGAGCCTAATCCACAAGGGGAGAGCCATCCACCTTTAAACTT

GGCATTTCTTGATATTCTCAGTGAATTTTCTTCTAAACTGCTCCGACAGGATAAAAGAACAGT GTATGTTTATTTGGAAAAGTTCATGACCTTTCAGAT

GTCACTCCGAAGAGAAGATGTATGGCTTCCTCTGATGTCTTACCGAAATTCTTTGCTAGCTGGTGGTGATGATGATACTATGTCAGTCATTAGTGGAATG

AGCAGTCGGGGATCAACTGTACGGAGTAAAAAATCAAAACCATCTACAGGAAAGCGGAAAGTGGTTGAAGGCATGCAACTAGCACTCC CTGAAGAAAGC

AGTAGCAGTGACAGTATGTGGTTGAGCAGAGAGCAAACACTGCACACCCCTGTCATGATGCAGACACCACAGCTCACCTCCACTATTATGAGAGAACCGA

AAAGGTTACGGCCTGAAGATAGCTTCATGAGTGTCTATCCGATGCAGGCAGAACACCATCAAACGCCTCTGGATTATAA TCGGCGTGGTACAAGCCTAA

TGGAAGATGATGAAGAGCCAATTGTTGAAGATGTTATGATGTCCTCAGAAGGAAGGATTGAGGATCTTAATGAGGGAATGGACTTTGACACCATGGATAT

AGACTTG - UNI4824 - CCACCATCAAAGAATAGAAGAGAGAGAACAGAACTGAAGCCCGATTTCTTTGATCCAGCTTCAATTATGGATGAATCA G

TTCTTGGGGTGTCAATGTTTTAATCCCAGTACACATTTAAATCTGTGGTGAAGTCGTTTTCTAAGTGGAAGAGGAAATTTGAAAATAAAGTGTGGTAGAT

ACAGTGAAATTCTGTACAGATTTTTCTCTAAGGAGAATATAACATGCTTATGCTTACCAAGATGAAGTGCATTGAGGGGCAGTTTTGTTTGCCTGAAAAA

ATAAAGGACAAGTAAACAATTTGATGATAAGCTACAGTTTTTCTTAGAAAGTAAATATTTTATTTATGCGCTGTTAGTTGGCTTTTAAAGGAATTATTTC

ATGCTTTTTTAAAAAATATAACAATCTGAAGAAGTATTTGGTACAGATAAGAATCTTCTCACATTTATTTACTGGTTGTACTAAATAATGATGACCTCTG

CTGGATTTCTGTTTACATCCACGAAACAAAAGTTAAGGATGGATTTATTCCCCGACCCTGAAATTGTAGGATAGAATTGTTTTTAGCATTCTAAATTTAA

ATGCTTAAAACATCAATCAACAAAACTTTGTTTTAAATGTTGTAATTGTGGAAAAAAAGTTAAACTTATAAGCAGAACTTTTACAATTTTTTCATCTAAA

ATGTATTTTAAGATATTTTTAAAATCCAAGAGCTTCTGTATACTTTTCAGAAATATCCAGATGCAGTGAACTGCCAGAAGGTAACCAGTCTTGAACATGC

TTATCCCATAGCAGCCCTGAACGTTTGCTTGTCCTTTAAGATAAAAATGTAACGTTGTGATATTCCTTCCAGTAGTGCCACTGTATTTTGTCTCCAAATA

AAAGAAGCTTATTGTAGTATGTTTGCAGAAAATTTAAACAAAAATTATACAGCTTATTAGAGTGTGGGAATAGGGATCTAAATTTTAAATAAAATTATAT

ATATATATAAATTGGTGCTGATTTTATAATTGCGCAGTTTGTTTAGTTTTTTCTTACTTTTAAATTCCAACTTAAAATTATGAGGTTTCAGAAATATATT

GAAAGTTTAACAATGTTTAAAAATAGAAAAGCATGACTGTTCATGCTTTAAAATGATTTTTAAATTTGTATTTTATATTGTTTTATCTATCTGTCTTTGC

AAGCAGTCTTCAGGTTAAAGATACTTCTAACAGGTTACAGTACATTTCCTCTGTATGTAAATTAGATGGGATAATAGAATTCATAACCCATAATATTCTT

TGAAAGCTAAGCTTTAAACTTCATTTTATGTCCTTTCACAAGTGAATTAGTTTAAAACAGAAAGTGGCCACTTGCCATTTTGACATCGACTCATTTTGCG

AGGCTTAGGCAGCTAGACATCGTTTAAAACAAAATATTAACTTATATTACATGTATATCTATCTTTTGTCAGTCGTCTCTCAGTTCTTGAGGTATATTAT

TTTAATCATTCCATGCCTTAATATGCTTGCAATACAAGAATATCTTCAGATGTGTGAATACCAAAAGGTTTCTGGTTTTTCGAGTCAGGAAATCAACAAG

CATTGGGCTGTGGTAGCCAAAAAACCATAGGTTAAATGAACGACCACAACATACATTTGTTTTATTAATTAATGGTTAACAAATAAAACCAGACTTGTCT

AACATACTTTCCATCAACAACCATTGTTACGTGCAAACATATTGCATATGTTCCTTCACACACCACTGCATTTCCTAGAACTGCTGAGAGGACTGTATAT

ATGATTTGAAACCTAGGTTGATTTCTTTTCTCACTCTTGAAAGGAGTATTTCTTTGTGAAAGCAGTTCTTCCAGCTTTGTTTTGAACCAGCTAAACTGTT

TTCTATATTACTCTAACCTGTTGTCCTCCACATTCTATTGTCCTAATTGTACTGTTTGCTGATTTGTATTTATGTCTTGAGACAGTAACTTTTTGAATAA

AAATAAACCTAC
Translation
 - UNI18774 - MIAAPEIPTDFNLLQ QESETHFSSDTDFEDIEGKNQKQGKGK TCKKGKKGPAEKGKSGNGGGKPPSGSNRMNGHHQQNGVENMM

LFEVVKMGKSAMQ SVVDDWIESYKHDRDIALLDLINFFIQCSGCKG GVVTAEMFRHMQNSEIIRKMTEEFDE DSGDYPLTMAGPQWKKFKSSFCEFI

GVLVRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAA AMKLMTALVNVALNLSINMDNTQRQYEAERNKMIGKRANERLELLLQKRKE LQE

NQDEIENMMNAIFKGVFVHRYR RDAIAEIRAICIEEIGIWMKMYSDAFLNDSYLKYVGWTMHDK QGEVRLKCLTALQGLYYNKELNSKLELFTSRFK 

DRIVSMTLDKEYDVAVQAIKLLTLVLQ QSSEEVLTAEDCENVYHLVYSAHRPVAVAAGEFLYKK KLFSRRDPEEDGLMKRRGRQGPNANLVKTLVFFF

LESE LHEHAAYLVDSMWDCATELLKDWECMNSLLLEEPLSGEEA ALTDRQESALIEIMLCTIRQAAECHPPVGRGTGKR VLTAKEKKTQLDDRTRIT

ELFAVALPQLLAK YSVDAEKVTNLLQLPQYFDLEIYTTGRLEK HLDALLRQIRNIVEKHTDTDVLEACSKTYHALCNEEFTIFNRVDISRSQLIDELA

DKFNRLLEDFLQE GEEPDEDDAYQVLSTLKRITAFHN NAHDLSKWDLFACNYKLLKTGIENGDMPEQ IVIHALQCAHYVILWQLAKITESTSTK ED

LLRLKKQMRVFCQICQHYLTNVNTTVKEQ AFTILCDILMIFSHQIMSGGRDMLEPLVYTPDSSLQSELLSFILDHVFIEQDDDSNSAD DGQQEDEASK

IEALHKRRNLLAAFCKLIVYTVVEMNTAADIFKQYMK YYNDYGDIIKETMSKTRQIDKIQCAKTLILSLQQ LFNEMIQENGYNFDRSSSTFSGIKELA

RRFALTFGLDQLKTREAIAMLHK KDGIEFAFKEPNPQGESHPPLNLAFLDILSEFSSKLLRQDKRTV VYVYLEKFMTFQMSLRREDVWLPLMSYRNSL

LAGGDDDTMSVISGMSSRGSTVRSKKSKPSTGKRKVVEGMQLALP PEESSSSDSMWLSREQTLHTPVMMQTPQLTSTIMREPKRLRPEDSFMSVYPMQA

EHHQTPLDYN NRRGTSLMEDDEEPIVEDVMMSSEGRIEDLNEGMDFDTMDIDL - UNI4824 - PPSKNRRERTELKPDFFDPASIMDES VLGVSM

F
Transcript ENSMUST00000115073
Sequence
AAAAGAAAGGAAAAAAAATACAGAAAAAAGGGAAAAAAACAAAACAAAACAAAAAAAGCACCCCGCCGGATCCGACCGCCACTTTCAAACCCCCCCACGG

CTCTAGACCCGCGGGAGCTTCCGTCCCTCAGTAGAACTCAAGGGTGGAAAGAAGAGGAAGGGGGAAAAATCTTGTACCAGCCCAGGGGTGAAGAAGCCCC

CGGCCTGAGAAAGAAGGAAGGAGTGGGGGAGGCCAACAGTCTCCTTGCTGCCTCTGTAGACGCTGAGGGGGGAG - UNI18774 - GAACTGTCTTTC

TTAGAGGAAGCACACTGTCATTTTACTCACATAAATATATGAATATATTTCTGACATTGGGGTGATCCAGAAGATGATAAAGAAATGATAGCAGCTCCAG

AAATACCAACTGATTTTAATCTACTGCA GGAGTCAGAGACACACTTTTCTTCTGACACAGATTTTGAAGACATTGAAGGAAAAAATCAGAAGCAAGGCA

AAGGCAAA ACTTGTAAAAAAGGCAAAAAGGGTCCAGCAGAAAAGGGTAAAAGTGGAAATGGAGGAGGAAAACCTCCTTCTGGCTCAAACCGAATGAACG

GTCATCATCAACAGAATGGAGTTGAAAACATGATGTTGTTCGAAGTTGTTAAAATGGGCAAGAGTGCTATGCAG TCGGTGGTAGATGACTGGATCGAGT

CCTACAAGCATGACCGGGACATAGCGCTTCTTGACCTTATCAATTTCTTTATTCAGTGCTCAGGCTGCAAAG GAGTCGTCACAGCAGAGATGTTCAGAC

ATATGCAGAACTCTGAGATAATTCGAAAAATGACAGAAGAATTTGACGAG GATAGTGGGGATTACCCACTTACCATGGCTGGTCCTCAGTGGAAGAAGT

TCAAGTCCAGCTTCTGTGAGTTCATTGGTGTGTTAGTACGGCAGTGTCAATACAGTATCATATATGATGAGTACATGATGGATACTGTCATTTCACTTCT

TACTGGATTGTCTGACTCCCAAGTCAGAGCATTTCGACATACAAGCACCCTGGCAG CTATGAAGTTGATGACTGCTTTGGTAAATGTGGCACTAAATCT

TAGCATTAATATGGATAACACACAAAGACAGTACGAGGCAGAACGGAATAAAATGATTGGAAAACGAGCTAACGAAAGGCTAGAACTCCTGTTACAAAAG

CGTAAAGAG CTTCAGGAAAATCAAGATGAGATAGAAAATATGATGAATGCAATATTTAAAGGAGTGTTTGTACATAGATACAG GGATGCAATAGCTGA

AATCAGAGCTATATGCATTGAAGAGATTGGCATTTGGATGAAGATGTATAGTGATGCCTTCCTTAATGACAGCTATTTAAAATATGTTGGTTGGACTATG

CATGATAAG CAAGGTGAAGTCAGACTCAAATGTCTTACTGCTTTACAAGGGCTTTACTATAACAAAGAACTTAATTCCAAACTGGAACTCTTTACCAGT

CGATTCAAG GATAGAATTGTGTCTATGACCCTTGACAAAGAATATGATGTTGCAGTACAAGCAATAAAGTTACTCACTCTTGTTTTACA GAGTAGTGA

AGAAGTTCTAACTGCAGAAGATTGTGAAAATGTCTATCATCTGGTTTATTCAGCTCACCGGCCAGTAGCAGTTGCAGCTGGAGAATTTCTCTACAAAAA 

GCTCTTCAGCCGCAGAGACCCAGAAGAGGATGGGCTGATGAAAAGAAGGGGAAGGCAAGGCCCGAATGCCAACCTTGTGAAGACTTTGGTGTTTTTCTTT

TTGGAAAGTGAG TTACACGAGCATGCAGCTTACCTTGTGGACAGCATGTGGGATTGTGCTACTGAGCTCCTGAAAGACTGGGAATGTATGAATAGCTTG

TTATTAGAAGAGCCTCTTAGTGGAGAGGAAG CTCTAACAGACAGACAAGAGAGTGCTTTGATTGAAATAATGCTTTGTACTATTAGACAAGCAGCTGAA

TGTCATCCTCCCGTGGGAAGAGGGACAGGAAAAAGG GTGCTGACAGCAAAGGAGAAGAAGACACAGTTGGATGACAGAACAAGAATCACTGAGCTGTTT

GCTGTGGCCCTTCCGCAGTTATTAGCTAAA TACTCTGTAGATGCAGAAAAGGTGACCAATTTGTTGCAGTTACCTCAGTACTTTGATTTGGAGATATAC

ACCACTGGACGATTAGAAAAG CATTTGGATGCCTTATTGCGCCAGATCCGAAATATTGTAGAGAAGCACACAGACACAGATGTTTTGGAAGCATGTTCT

AAAACTTACCATGCATTATGTAACGAAGAGTTCACCATCTTCAACAGAGTAGATATTTCAAGAAGTCAGCTGATTGATGAACTGGCAGATAAATTTAACC

GGCTTCTTGAAGATTTTCTGCAAGAG GGAGAAGAACCTGATGAAGATGACGCATATCAGGTATTGTCAACATTGAAGAGGATCACTGCTTTTCATAA T

GCTCATGATCTTTCAAAGTGGGATTTGTTCGCTTGTAATTACAAACTCTTGAAAACCGGAATCGAAAATGGAGATATGCCTGAGCAG ATTGTTATTCAC

GCACTGCAGTGTGCTCACTATGTAATCCTTTGGCAGCTTGCTAAGATCACTGAAAGCACGTCTACAAAG GAGGACTTACTGCGCTTAAAGAAACAGATG

AGGGTATTTTGCCAGATATGTCAGCATTACTTGACCAACGTGAATACTACTGTTAAAGAACAG GCCTTCACTATTCTGTGTGACATTTTGATGATCTTC

AGTCACCAGATTATGTCTGGAGGGCGTGACATGTTAGAGCCATTAGTTTATACTCCTGATTCTTCATTGCAGTCTGAGTTGCTCAGCTTTATTTTGGATC

ATGTCTTCATTGAACAGGATGATGATAGTAATAGTGCAG ATGGTCAGCAAGAGGATGAAGCCAGCAAAATTGAAGCTTTGCACAAGAGGAGAAATTTAC

TTGCAGCATTTTGTAAGCTAATTGTATATACCGTGGTGGAGATGAACACAGCTGCAGATATCTTCAAGCAGTATATGAAG TATTATAATGATTATGGCG

ATATCATCAAAGAAACAATGAGTAAAACAAGGCAGATTGACAAAATTCAGTGTGCTAAGACCCTTATTCTCAGTTTGCAGCAG CTTTTTAATGAGATGA

TACAAGAGAATGGCTATAATTTTGATAGATCATCCTCAACATTTAGTGGCATAAAAGAACTTGCTCGGCGTTTTGCTTTAACTTTTGGACTTGATCAATT

GAAAACCAGAGAAGCCATTGCCATGCTCCACAA AGATGGTATAGAATTTGCTTTTAAGGAGCCTAATCCACAAGGGGAGAGCCATCCACCTTTAAACTT

GGCATTTCTTGATATTCTCAGTGAATTTTCTTCTAAACTGCTCCGACAGGATAAAAGAACAGT GTATGTTTATTTGGAAAAGTTCATGACCTTTCAGAT

GTCACTCCGAAGAGAAGATGTATGGCTTCCTCTGATGTCTTACCGAAATTCTTTGCTAGCTGGTGGTGATGATGATACTATGTCAGTCATTAGTGGAATG

AGCAGTCGGGGATCAACTGTACGGAGTAAAAAATCAAAACCATCTACAGGAAAGCGGAAAGTGGTTGAAGGCATGCAACTAGCACTCC CTGAAGAAAGC

AGTAGCAGTGACAGTATGTGGTTGAGCAGAGAGCAAACACTGCACACCCCTGTCATGATGCAGACACCACAGCTCACCTCCACTATTATGAGAGAACCGA

AAAGGTTACGGCCTGAAGATAGCTTCATGAGTGTCTATCCGATGCAGGCAGAACACCATCAAACGCCTCTGGATTATAA CACGCAGGTAACATGGATGT

TAGCTCAAAGACAACAAGAGGAAGCAAGGCAACAGCAGGAGAGAGCAGCAATGAGCTATGTTAAACTGCGAACTAATCTTCAGCATGCCAT TCGGCGTG

GTACAAGCCTAATGGAAGATGATGAAGAGCCAATTGTTGAAGATGTTATGATGTCCTCAGAAGGAAGGATTGAGGATCTTAATGAGGGAATGGACTTTGA

CACCATGGATATAGACTTG - UNI4824 - CCACCATCAAAGAATAGAAGAGAGAGAACAGAACTGAAGCCCGATTTCTTTGATCCAGCTTCAATTAT

GGATGAATCA GTTCTTGGGGTGTCAATGTTTTAATCCCAGTACACATTTAAATCTGTGGTGAAGTCGTTTTCTAAGTGGAAGAGGAAATTTGAAAATAA

AGTGTGGTAGATACAGTGAAATTCTGTACAGATTTTTCTCTAAGGAGAATATAACATGCTTATGCTTACCAAGATGAAGTGCATTGAGGGGCAGTTTTGT

TTGCCTGAAAAAATAAAGGACAAGTAAACAATTTGATGATAAGCTACAGTTTTTCTTAGAAAGTAAATATTTTATTTATGCGCTGTTAGTTGGCTTTTAA

AGGAATTATTTCATGCTTTTTTAAAAAATATAACAATCTGAAGAAGTATTTGGTACAGATAAGAATCTTCTCACATTTATTTACTGGTTGTACTAAATAA

TGATGACCTCTGCTGGATTTCTGTTTACATCCACGAAACAAAAGTTAAGGATGGATTTATTCCCCGACCCTGAAATTGTAGGATAGAATTGTTTTTAGCA

TTCTAAATTTAAATGCTTAAAACATCAATCAACAAAACTTTGTTTTAAATGTTGTAATTGTGGAAAAAAAGTTAAACTTATAAGCAGAACTTTTACAATT

TTTTCATCTAAAATGTATTTTAAGATATTTTTAAAATCCAAGAGCTTCTGTATACTTTTCAGAAATATCCAGATGCAGTGAACTGCCAGAAGGTAACCAG

TCTTGAACATGCTTATCCCATAGCAGCCCTGAACGTTTGCTTGTCCTTTAAGATAAAAATGTAACGTTGTGATATTCCTTCCAGTAGTGCCACTGTATTT

TGTCTCCAAATAAAAGAAGCTTATTGTAGTATGTTTGCAGAAAATTTAAACAAAAATTATACAGCTTATTAGAGTGTGGGAATAGGGATCTAAATTTTAA

ATAAAATTATATATATATATAAATTGGTGCTGATTTTATAATTGCGCAGTTTGTTTAGTTTTTTCTTACTTTTAAATTCCAACTTAAAATTATGAGGTTT

CAGAAATATATTGAAAGTTTAACAATGTTTAAAAATAGAAAAGCATGACTGTTCATGCTTTAAAATGATTTTTAAATTTGTATTTTATATTGTTTTATCT

ATCTGTCTTTGCAAGCAGTCTTCAGGTTAAAGATACTTCTAACAGGTTACAGTACATTTCCTCTGTATGTAAATTAGATGGGATAATAGAATTCATAACC

CATAATATTCTTTGAAAGCTAAGCTTTAAACTTCATTTTATGTCCTTTCACAAGTGAATTAGTTTAAAACAGAAAGTGGCCACTTGCCATTTTGACATCG

ACTCATTTTGCGAGGCTTAGGCAGCTAGACATCGTTTAAAACAAAATATTAACTTATATTACATGTATATCTATCTTTTGTCAGTCGTCTCTCAGTTCTT

GAGGTATATTATTTTAATCATTCCATGCCTTAATATGCTTGCAATACAAGAATATCTTCAGATGTGTGAATACCAAAAGGTTTCTGGTTTTTCGAGTCAG

GAAATCAACAAGCATTGGGCTGTGGTAGCCAAAAAACCATAGGTTAAATGAACGACCACAACATACATTTGTTTTATTAATTAATGGTTAACAAATAAAA

CCAGACTTGTCTAACATACTTTCCATCAACAACCATTGTTACGTGCAAACATATTGCATATGTTCCTTCACACACCACTGCATTTCCTAGAACTGCTGAG

AGGACTGTATATATGATTTGAAACCTAGGTTGATTTCTTTTCTCACTCTTGAAAGGAGTATTTCTTTGTGAAAGCAGTTCTTCCAGCTTTGTTTTGAACC

AGCTAAACTGTTTTCTATATTACTCTAACCTGTTGTCCTCCACATTCTATTGTCCTAATTGTACTGTTTGCTGATTTGTATTTATGTCTTGAGACAGTAA

CTTTTTGAATAAAAATAAACCTAC
Translation
 - UNI18774 - MIAAPEIPTDFNLLQ QESETHFSSDTDFEDIEGKNQKQGKGK TCKKGKKGPAEKGKSGNGGGKPPSGSNRMNGHHQQNGVENMM

LFEVVKMGKSAMQ SVVDDWIESYKHDRDIALLDLINFFIQCSGCKG GVVTAEMFRHMQNSEIIRKMTEEFDE DSGDYPLTMAGPQWKKFKSSFCEFI

GVLVRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAA AMKLMTALVNVALNLSINMDNTQRQYEAERNKMIGKRANERLELLLQKRKE LQE

NQDEIENMMNAIFKGVFVHRYR RDAIAEIRAICIEEIGIWMKMYSDAFLNDSYLKYVGWTMHDK QGEVRLKCLTALQGLYYNKELNSKLELFTSRFK 

DRIVSMTLDKEYDVAVQAIKLLTLVLQ QSSEEVLTAEDCENVYHLVYSAHRPVAVAAGEFLYKK KLFSRRDPEEDGLMKRRGRQGPNANLVKTLVFFF

LESE LHEHAAYLVDSMWDCATELLKDWECMNSLLLEEPLSGEEA ALTDRQESALIEIMLCTIRQAAECHPPVGRGTGKR VLTAKEKKTQLDDRTRIT

ELFAVALPQLLAK YSVDAEKVTNLLQLPQYFDLEIYTTGRLEK HLDALLRQIRNIVEKHTDTDVLEACSKTYHALCNEEFTIFNRVDISRSQLIDELA

DKFNRLLEDFLQE GEEPDEDDAYQVLSTLKRITAFHN NAHDLSKWDLFACNYKLLKTGIENGDMPEQ IVIHALQCAHYVILWQLAKITESTSTK ED

LLRLKKQMRVFCQICQHYLTNVNTTVKEQ AFTILCDILMIFSHQIMSGGRDMLEPLVYTPDSSLQSELLSFILDHVFIEQDDDSNSAD DGQQEDEASK

IEALHKRRNLLAAFCKLIVYTVVEMNTAADIFKQYMK YYNDYGDIIKETMSKTRQIDKIQCAKTLILSLQQ LFNEMIQENGYNFDRSSSTFSGIKELA

RRFALTFGLDQLKTREAIAMLHK KDGIEFAFKEPNPQGESHPPLNLAFLDILSEFSSKLLRQDKRTV VYVYLEKFMTFQMSLRREDVWLPLMSYRNSL

LAGGDDDTMSVISGMSSRGSTVRSKKSKPSTGKRKVVEGMQLALP PEESSSSDSMWLSREQTLHTPVMMQTPQLTSTIMREPKRLRPEDSFMSVYPMQA

EHHQTPLDYN NTQVTWMLAQRQQEEARQQQERAAMSYVKLRTNLQHAI IRRGTSLMEDDEEPIVEDVMMSSEGRIEDLNEGMDFDTMDIDL - UNI4

824 - PPSKNRRERTELKPDFFDPASIMDES VLGVSMF

For any suggestions or comments, please send an email to unitrap@crg.es