Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025892 (Gria4)
Chromosomal location
Chr 9: 4417896 - 4796142 (-)
Description
glutamate receptor, ionotropic, AMPA4 (alpha 4) Gene [Source:MGI Symbol;Acc:MGI:95811]
RefSeq_dna
NM_019691 
RefSeq_peptide
NP_001106651.1 NP_001106652.1 NP_062665.3 
UniGene
Mm.209263 
MGI
MGI:95811 
Uniprot/SWISSPROT
Q9Z2W8 
Uniprot/SPTREMBL
Q8BXG8 Q8C069 Q6P9M7 Q8C0E4 
Human Ortholog
ENSG00000152578 (GRIA4)
Omim not available
UniTrap UNI30565
Vector Insertion
Chr 9: 4664767 - 4793969
Public Clones (sanger) IST12222A3HMR1 (tigm) IST10945H3 (tigm) IST14396E11 (tigm)
IST14317E9 (tigm) IST14873E3 (tigm) IST14328E1 (tigm) IST12319F2 (tigm)
IST11610G8 (tigm) IST14515F8 (tigm) IST11323B9 (tigm) IST10264B8 (tigm)
IST14435B5 (tigm) IST14541C1 (tigm) IST14525E2 (tigm) IST14486D11 (tigm)
IST10915F6 (tigm) IST15076B4 (tigm) IST15054F8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32955
Vector Insertion
Chr 9: 4537634 - 4665008
Public Clones IST12643B6 (tigm) IST10922D6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30752
Vector Insertion
Chr 9: 4464113 - 4472219
Public Clones (sanger) IST14421H8 (tigm) IST10546B3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36866
Vector Insertion
Chr 9: 4461905 - 4464485
Public Clones IST13331E1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027020
Sequence
GGGGACTGAGACCATGGGGAGGTGCTAACTTCCTCTCCAACCCCCCAGCCCGGGATCCGGGCTGGCATACCCGGCCCCCCGGGGTAGTTTCCTGCCAAGC

TCAACCAAGAATCCAAAGGCGACTTGGAGGGCATAAAAAGAAAAACACTGGTTCTGAAGAGGGGCCCCCACCTCCAGAGCCGGTTCCTCGGCAAACGCGC

GGAAGGTAGGAGGAAGGGGATCAGATACTGGAGACTGTACGCCAAAACCCCAGCCTGAAGACTCGCTCCAGAGCCTCCCTGAAGACCTGGGCGATCTG C

GCCATCATCTTCAATGCCTCTCTGAAAATCATTTAGCAAGAGTGAGAGAAAGAGAGGAGAGCGCGCACCAGGGAGAGGAGCAAAGAAGATGAGGATTATT

TGCAGGCAGATTGTCTTGTTGTTTTCTGGATTTTGGGGACTCGCCATGGGAGCCTTTCCGAGCAGCGTTCAAATAG - UNI30565 - GTGGTCTCTT

TATCCGAAACACAGACCAGGAATACACTGCTTTTCGGCTAGCTATCTTTCTTCATAACACCAGCCCCAATGCATCTGAAGCCCCTTTCAATTTGGTACCT

CATGTGGACAACATTGAGACTGCCAACAGTTTTGCTGTGACAAATGCAT - UNI30565 - - UNI32954 - TCTGTTCCCAGTATTCTAGAGGGG

TGTTTGCCATTTTTGGACTCTATGACAAGAGGTCAGTGCATACCTTGACCTCCTTCTGCAGTGCTCTGCACATCTCTCTCATCACACCAAGCTTCCCCAC

TGAAGGAGAGAGCCAGTTCGTGCTTCAGCTAAGACCTTCATTGAGAGGTGCACTCCTGAGCCTCCTGGATCACTATGAATGGAATTGTTTTGTCTTCCTG

TATGATACAGACAGGG - UNI30565 - - UNI32954 - GGTATTCAATACTTCAAGCTATAATGGAAAAAGCAGGACAGAATGGATGGCATGTCA

GTGCGATATGTGTGGAAAATTTTAACGATGTCAGCTACAGGCAACTACTAGAAGAGCTTGACAGAAGACAAGAGAAGAAATTTGTAATAGATTGTGAGAT

AGAAAGGCTTCAAAACATATTAGAACAA - UNI32954 - ATTGTGAGTGTTGGGAAGCACGTCAAAGGCTACCATTATATCATCGCAAATTTG GGT

TTCAAAGATATTTCTCTTGAGAGATTTATACATGGAGGAGCAAATGTCACTGGATTCCAGTTAGTAGATTTTAATACGCCCATGGTGACGAAACTAATGG

ATCGCTGGAAGAAACTAGATCAACGAGAATATCCAGGATCTGAAACACCTCCAAAG TACACTTCTGCTCTCACTTACGATGGTGTCTTGGTAATGGCTG

AAACTTTCCGAAGTCTCAGAAGACAGAAAATTGATATTTCAAGGAGAGGAAATGCCGGGGATTGTCTGGCAAACCCTGCTGCTCCCTGGGGCCAGGGAAT

TGACATGGAGAGAACACTGAAGCAG GTTCGAATTCAAGGACTGACTGGGAATGTTCAATTTGACCACTATGGACGTAGAGTTAATTACACAATGGATGT

GTTTGAATTAAAAAGCACAGGACCTCGAAAG GTTGGCTATTGGAACGATATGGATAAATTAGTCTTGATTCAAGATGCGCCTACTCTTGGCAATGACAC

AGCAGCTATCGAGAACAGAACAGTGGTTGTAACCACAATTATG - UNI30750 - GAATCCCCCTACGTTATGTACAAGAAAAATCATGAAATGTTTG

AAGGAAATGACAAGTATGAAGGCTACTGTGTAGACTTGGCATCTGAAATTGCGAAACATATCGGTATCAAATATAAAATTGCCATTGTCCCTGATGGAAA

ATATGGAGCAAGGGATGCGGACACCAAAATTTGGAATGGGATGGTAGGAGAGCTTGTGTATGGG - UNI30750 - - UNI36866 - AAAGCAGAG

ATTGCCATTGCACCTCTGACAATCACGTTGGTGCGAGAGGAGGTCATCGACTTTTCTAAGCCTTTTATGAGTTTAGGCATCTCTATCATGATCAAAAAAC

CTCAGAAATCTAAACCAGGAGTGTTTTCCTTCTTGGACCCTCTGGCCTATGAGATCTGGATGTGCATAGTGTTTGCATACATTGGTGTCAGCGTGGTCTT

GTTCCTAGTCAGTAGGTTTAGCCCATATGAGTGGCACACAGAAGAGCCTGAGGATGGAAAAGAAGGACCCAGTGACCAACCTCCCAATGAGTTTGGCATC

TTTAACAGCCTCTGGTTTTCCCTGGGTGCCTTTATGCAACAAGGATGTGACATTTCACCCAG - UNI30750 - - UNI36866 - ATCCCTGTCCG

GTCGGATTGTTGGAGGCGTATGGTGGTTCTTCACTCTCATCATTATCTCATCCTACACTGCTAATCTGGCTGCATTCCTGACAGTGGAGAGAATGGTCTC

CCCCATAGAAAGTGCAGAAGACCTGGCCAAACAAACAGAAATTGCCTATGGAACACTTGATTCGGGATCAACAAAAGAATTCTTCAGA - UNI36866 

- AGATCAAAAATAGCAGTATATGAAAAGATGTGGACCTACATGCGATCGGCAGAGCCATCTGTGTTCACTAGAACTACAGCTGAGGGCGTGGCCCGTGT

CCGCAAGTCCAAGGGCAAATTTGCCTTCCTCCTGGAGTCCACGATGAATGAATACATTGAGCAGCGAAAGCCCTGTGACACGATGAAAGTGGGAGGAAAC

CTGGATTCCAAAGGCTATGGTGTAGCGACGCCCAAGGGTTCCTCATTAAG AAATGCTGTTAACCTCGCAGTTTTAAAACTGAATGAACAAGGCCTCTTG

GACAAATTGAAAAACAAATGGTGGTACGACAAAGGAGAATGTGGCAGCGGGGGAGGTGACTCCAAG GACAAGACGAGTGCCTTGAGCCTGAGCAACGTA

GCAGGCGTCTTCTACATTCTGGTTGGCGGCTTGGGCTTGGCAATGCTGGTGGCTTTGATAGAGTTCTGTTACAAGTCCAGGGCAGAGGCGAAGAGAATGA

AG CTGACTTTTTCCGAAGCCATAAGAAACAAAGCCAGGTTATCCATCACTGGGAGTGTGGGAGAAAACGGCCGTGTGCTGACCCCCGACTGCCCCAAGG

CCGTACACACAGGAACTGCGATTAGACAGAGCTCGGGATTGGCTGTCATTGCATCGGACCTACCATAAAAACCAAAAAATTAATTGAGTGCCTTAATCAA

ACTGTGTTGGTGACTGATGGAAACGCAGCCCCGAGGGACAGGCCAAGCGTGGGTCTTGGCTAAACCCATCCTTTGACTGAGCAGGAAGGACATCCTGAGT

GCCGGACAGAACCAGTGCATGAGTTCCGCACGGAAATGCAGACTCGGATTTTTTTATCAGGAAATCTCACAGTTTAGTTTTTTGGGGGGAGTGGGTGGGG

TACCTTAGGTGTATTAACAGCAACAGATCTCACTTGAGCGCACTTAAAACTAATCAGACTGGCCAGTTAGCGCATTAAACTGTGAAGTTCTTTCTCAGAA

AGGTCGTGGTCACCACAGCCAGGGATCAACAGTTAATAGAGGTCAAAGAACCTGCTACCTGTGTCTCCAGAACACCCATATAGTCCATGGAATAATCTTC

CGCTGAGACAAGCCGTCACTAACATGTGATAGGAAAATAATAAATAGATAAAGCCTGTGAACAAACAATGAGATTTAAAGAAAGTATTTACAGTTACTTT

GGAAATAAAACAATACTGAAACATGCTTGCTTTTTAACTGAAGTTAATCCAGTAGAGGACAACGCAATTGTTTTTTCTAACCATCTTAGGGAACAATACA

TTGCAATAATTGATAATAGTGCCATCACTGTAATAAACTTTAGAGACTTTTTTTAATGTAAAAGTTGTTGGTCACCTTGTTTCCTGTAACCTTCACTCTG

TCACACAAGTTGGCTCATAGGTTGTGTTTGTCTATCAGAAATAAGAAAAACACAAGTGAAGAAAATGTTGGCATGAAGTCATCCATCTGCAATGAAAAAC

CTAAAAGACTACGGGTCACTCATGTTATCAATATAATTTATAATCCTGTTCAGTGTACAAAATTGTGGGTTTTGTACTCACCCAAAAGACTAAAACACCA

GTTTTTCTTACAGTATCTATCTACAGAGCTTATTCTCCCCTATTATTTGGGAAACTCTGAGACTCCATATTGCAGAAGTCAAGGAATAGGCCATATAAGA

AAATGTAGCTTGTTTTTATTATTTCTGCATATTTATTTCTAGATCTTGGGCTCATTTGTTAACAGAATAAGTTGTCAAAGGTAAAGTCCTTGAGTCTGGG

AATGAGCCATCGTTCCAAAACCAACACACCCTGTGTGGAAATTTTACTTGACTCTGTTTTGCTGCATAGAATTCAGTGTCTCTTGGCCATTCCCCCTCAT

TCCTATACTAAATTCTTTGAAGACACTGGTAACAGTTTGTGGTAGACTACAGTTGAAAAAACTCAATCCTTATTTCTACCAAGTAATTGTGAGTAAAATT

ATACCATGATCATTTTTAAGAAAAGAAAACCCTTATGGTTCAAAAGGTCTGGTTCATTTGAAATGATGAATGAGTTCAATGATACAGTTTTTAAAAAACC

AAAACAAACAAACAAACAAAAACAAATCACAGATTGAGGGATCTTTGCAGAAAGCACAAATTAGGATGATGCCCAAAGTGTGGCCTTGAAGAATGAGTTG

AGTTTTCACAGGAGAAGGTGCTGGTAAGATCCTAGGCGTGAGCAGCACACATAGCTGCTTCTTTTATCAGTGTTTCATGTACAAGGCTTGTGCAACCAGG

TGGCCTGGTGAGGGCACAGGGTGTGACACCATGGAAGCTCTGTCAGAAATATGGAGAATTGGTTTCCTTCCCTCAATACTTACAATCCCATTCAATAACT

GTGTGTCACTACAATGTAATCCTTATAATACATGTATGCACTGTCCTTTGGGAAAGGTTACTTCTCTGTTGTTGAGCAATGATTCATTTCACAACCTAGG

CCACTCCCTGGTATCTTCCTCTTCCTCTCTCACTCCTACCCAAGCTCTCAGCCAGCAAATGGACCTCCACAGCACACGGAACACGGCATCTACTGTGTCT

TTGATCTGTAGATCTTTTTTGTCTTTACCTGACTGTCACACATCCTTCAGCCCTGAAATTGAATTTTATGTGTACTGAGAAGATTTCCATGATTACCCAC

CACCCTGCCCATGACACTGAGTTACCTGCCATTCTTAATGTTTCTTACCCATCATGGCACTCATCGTACTGCATTGTAATTGCCTGTGTACTTGTCTATA

AACTACTAGACTGTCAGCTCCTTGAGGGCAGGGACTGTGTCTATTTTGTTCACAGTTGTATCCCCAGCACCCAGCACAGTGCCTGGCATATTGTAGGTGC

TTAATAAATATTTGTTGAATGAAA
Translation
 MRIICRQIVLLFSGFWGLAMGAFPSSVQIG - UNI30565 - GGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDNIETANSFAVTNAF 

- UNI30565 - - UNI32954 - FCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVF

LYDTDRG - UNI30565 - - UNI32954 - GYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQ - U

NI32954 - IVSVGKHVKGYHYIIANL GFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPK YTSALTYDGVLVMAETF

RSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQ VRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRK VGYWNDMDKLVLIQDAPTLGNDTA

AIENRTVVVTTIM - UNI30750 - ESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYG - U

NI30750 - - UNI36866 - KAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFS

PYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPR - UNI30750 - - UNI36866 - RSLSGRIVGGVWWFFTLIIISSYTAN

LAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFR - UNI36866 - RSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLE

STMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLR RNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSK DKTSALSLSNVAGVFYILVGG

LGLAMLVALIEFCYKSRAEAKRMK LTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASDLP
Transcript ENSMUST00000063508
Sequence
GGGGACTGAGACCATGGGGAGGTGCTAACTTCCTCTCCAACCCCCCAGCCCGGGATCCGGGCTGGCATACCCGGCCCCCCGGGGTAGTTTCCTGCCAAGC

TCAACCAAGAATCCAAAGGCGACTTGGAGGGCATAAAAAGAAAAACACTGGTTCTGAAGAGGGGCCCCCACCTCCAGAGCCGGTTCCTCGGCAAACGCGC

GGAAGGTAGGAGGAAGGGGATCAGATACTGGAGACTGTACGCCAAAACCCCAGCCTGAAGACTCGCTCCAGAGCCTCCCTGAAGACCTGGGCGATCTG C

GCCATCATCTTCAATGCCTCTCTGAAAATCATTTAGCAAGAGTGAGAGAAAGAGAGGAGAGCGCGCACCAGGGAGAGGAGCAAAGAAGATGAGGATTATT

TGCAGGCAGATTGTCTTGTTGTTTTCTGGATTTTGGGGACTCGCCATGGGAGCCTTTCCGAGCAGCGTTCAAATAG - UNI30565 - GTGGTCTCTT

TATCCGAAACACAGACCAGGAATACACTGCTTTTCGGCTAGCTATCTTTCTTCATAACACCAGCCCCAATGCATCTGAAGCCCCTTTCAATTTGGTACCT

CATGTGGACAACATTGAGACTGCCAACAGTTTTGCTGTGACAAATGCAT - UNI30565 - - UNI32954 - TCTGTTCCCAGTATTCTAGAGGGG

TGTTTGCCATTTTTGGACTCTATGACAAGAGGTCAGTGCATACCTTGACCTCCTTCTGCAGTGCTCTGCACATCTCTCTCATCACACCAAGCTTCCCCAC

TGAAGGAGAGAGCCAGTTCGTGCTTCAGCTAAGACCTTCATTGAGAGGTGCACTCCTGAGCCTCCTGGATCACTATGAATGGAATTGTTTTGTCTTCCTG

TATGATACAGACAGGG - UNI30565 - - UNI32954 - GGTATTCAATACTTCAAGCTATAATGGAAAAAGCAGGACAGAATGGATGGCATGTCA

GTGCGATATGTGTGGAAAATTTTAACGATGTCAGCTACAGGCAACTACTAGAAGAGCTTGACAGAAGACAAGAGAAGAAATTTGTAATAGATTGTGAGAT

AGAAAGGCTTCAAAACATATTAGAACAA - UNI32954 - ATTGTGAGTGTTGGGAAGCACGTCAAAGGCTACCATTATATCATCGCAAATTTG GGT

TTCAAAGATATTTCTCTTGAGAGATTTATACATGGAGGAGCAAATGTCACTGGATTCCAGTTAGTAGATTTTAATACGCCCATGGTGACGAAACTAATGG

ATCGCTGGAAGAAACTAGATCAACGAGAATATCCAGGATCTGAAACACCTCCAAAG TACACTTCTGCTCTCACTTACGATGGTGTCTTGGTAATGGCTG

AAACTTTCCGAAGTCTCAGAAGACAGAAAATTGATATTTCAAGGAGAGGAAATGCCGGGGATTGTCTGGCAAACCCTGCTGCTCCCTGGGGCCAGGGAAT

TGACATGGAGAGAACACTGAAGCAG GTTCGAATTCAAGGACTGACTGGGAATGTTCAATTTGACCACTATGGACGTAGAGTTAATTACACAATGGATGT

GTTTGAATTAAAAAGCACAGGACCTCGAAAG GTTGGCTATTGGAACGATATGGATAAATTAGTCTTGATTCAAGATGCGCCTACTCTTGGCAATGACAC

AGCAGCTATCGAGAACAGAACAGTGGTTGTAACCACAATTATG - UNI30750 - GAATCCCCCTACGTTATGTACAAGAAAAATCATGAAATGTTTG

AAGGAAATGACAAGTATGAAGGCTACTGTGTAGACTTGGCATCTGAAATTGCGAAACATATCGGTATCAAATATAAAATTGCCATTGTCCCTGATGGAAA

ATATGGAGCAAGGGATGCGGACACCAAAATTTGGAATGGGATGGTAGGAGAGCTTGTGTATGGG - UNI30750 - - UNI36866 - AAAGCAGAG

ATTGCCATTGCACCTCTGACAATCACGTTGGTGCGAGAGGAGGTCATCGACTTTTCTAAGCCTTTTATGAGTTTAGGCATCTCTATCATGATCAAAAAAC

CTCAGAAATCTAAACCAGGAGTGTTTTCCTTCTTGGACCCTCTGGCCTATGAGATCTGGATGTGCATAGTGTTTGCATACATTGGTGTCAGCGTGGTCTT

GTTCCTAGTCAGTAGGTTTAGCCCATATGAGTGGCACACAGAAGAGCCTGAGGATGGAAAAGAAGGACCCAGTGACCAACCTCCCAATGAGTTTGGCATC

TTTAACAGCCTCTGGTTTTCCCTGGGTGCCTTTATGCAACAAGGATGTGACATTTCACCCAG - UNI30750 - - UNI36866 - ATCCCTGTCCG

GTCGGATTGTTGGAGGCGTATGGTGGTTCTTCACTCTCATCATTATCTCATCCTACACTGCTAATCTGGCTGCATTCCTGACAGTGGAGAGAATGGTCTC

CCCCATAGAAAGTGCAGAAGACCTGGCCAAACAAACAGAAATTGCCTATGGAACACTTGATTCGGGATCAACAAAAGAATTCTTCAGA - UNI36866 

- AGATCAAAAATAGCAGTATATGAAAAGATGTGGACCTACATGCGATCGGCAGAGCCATCTGTGTTCACTAGAACTACAGCTGAGGGCGTGGCCCGTGT

CCGCAAGTCCAAGGGCAAATTTGCCTTCCTCCTGGAGTCCACGATGAATGAATACATTGAGCAGCGAAAGCCCTGTGACACGATGAAAGTGGGAGGAAAC

CTGGATTCCAAAGGCTATGGTGTAGCGACGCCCAAGGGTTCCTCATTAAG AACTCCTGTAAACCTTGCCGTTTTGAAACTCAGTGAGGCAGGCGTCTTA

GACAAGCTGAAAAACAAATGGTGGTACGATAAAGGTGAATGTGGACCCAAGGACTCGGGAAGCAAG GACAAGACGAGTGCCTTGAGCCTGAGCAACGTA

GCAGGCGTCTTCTACATTCTGGTTGGCGGCTTGGGCTTGGCAATGCTGGTGGCTTTGATAGAGTTCTGTTACAAGTCCAGGGCAGAGGCGAAGAGAATGA

AG CTGACTTTTTCCGAAGCCATAAGAAACAAAGCCAGGTTATCCATCACTGGGAGTGTGGGAGAAAACGGCCGTGTGCTGACCCCCGACTGCCCCAAGG

CCGTACACACAGGAACTGCGATTAGACAGAGCTCGGGATTGGCTGTCATTGCATCGGACCTACCATAAAAACCAAAAAATTAATTGAGTGCCTTAATCAA

ACTGTGTTGGTGACTGATGGAAACGCAGCCCCGAGGGACAGGCCAAGCGTGGGTCTTGGCTAAACCCATCCTTTGACTGAGCAGGAAGGACATCCTGAGT

GCCGGACAGAACCAGTGCATGAGTTCCGCACGGAAATGCAGACTCGGATTTTTTTATCAGGAAATCTCACAGTTTAGTTTTTTGGGGGGAGTGGGTGGGG

TACCTTAGGTGTATTAACAGCAACAGATCTCACTTGAGCGCACTTAAAACTAATCAGACTGGCCAGTTAGCGCATTAAACTGTGAAGTTCTTTCTCAGAA

AGGTCGTGGTCACCACAGCCAGGGATCAACAGTTAATAGAGGTCAAAGAACCTGCTACCTGTGTCTCCAGAACACCCATATAGTCCATGGAATAATCTTC

CGCTGAGACAAGCCGTCACTAACATGTGATAGGAAAATAATAAATAGATAAAGCCTGTGAACAAACAATGAGATTTAAAGAAAGTATTTACAGTTACTTT

GGAAATAAAACAATACTGAAACATGCTTGCTTTTTAACTGAAGTTAATCCAGTAGAGGACAACGCAATTGTTTTTTCTAACCATCTTAGGGAACAATACA

TTGCAATAATTGATAATAGTGCCATCACTGTAATAAACTTTAGAGACTTTTTTTAATGTAAAAGTTGTTGGTCACCTTGTTTCCTGTAACCTTCACTCTG

TCACACAAGTTGGCTCATAGGTTGTGTTTGTCTATCAGAAATAAGAAAAACACAAGTGAAGAAAATGTTGGCATGAAGTCATCCATCTGCAATGAAAAAC

CTAAAAGACTACGGGTCACTCATGTTATCAATATAATTTATAATCCTGTTCAGTGTACAAAATTGTGGGTTTTGTACTCACCCAAAAGACTAAAACACCA

GTTTTTCTTACAGTATCTATCTACAGAGCTTATTCTCCCCTATTATTTGGGAAACTCTGAGACTCCATATTGCAGAAGTCAAGGAATAGGCCATATAAGA

AAATGTAGCTTGTTTTTATTATTTCTGCATATTTATTTCTAGATCTTGGGCTCATTTGTTAACAGAATAAGTTGTCAAAGGTAAAGTCCTTGAGTCTGGG

AATGAGCCATCGTTCCAAAACCAACACACCCTGTGTGGAAATTTTACTTGACTCTGTTTTGCTGCATAGAATTCAGTGTCTCTTGGCCATTCCCCCTCAT

TCCTATACTAAATTCTTTGAAGACACTGGTAACAGTTTGTGGTAGACTACAGTTGAAAAAACTCAATCCTTATTTCTACCAAGTAATTGTGAGTAAAATT

ATACCATGATCATTTTTAAGAAAAGAAAACCCTTATGGTTCAAAAGGTCTGGTTCATTTGAAATGATGAATGAGTTCAATGATACAGTTTTTAAAAAACC

AAAACAAACAAACAAACAAAAACAAATCACAGATTGAGGGATCTTTGCAGAAAGCACAAATTAGGATGATGCCCAAAGTGTGGCCTTGAAGAATGAGTTG

AGTTTTCACAGGAGAAGGTGCTGGTAAGATCCTAGGCGTGAGCAGCACACATAGCTGCTTCTTTTATCAGTGTTTCATGTACAAGGCTTGTGCAACCAGG

TGGCCTGGTGAGGGCACAGGGTGTGACACCATGGAAGCTCTGTCAGAAATATGGAGAATTGGTTTCCTTCCCTCAATACTTACAATCCCATTCAATAACT

GTGTGTCACTACAATGTAATCCTTATAATACATGTATGCACTGTCCTTTGGGAAAGGTTACTTCTCTGTTGTTGAGCAATGATTCATTTCACAACCTAGG

CCACTCCCTGGTATCTTCCTCTTCCTCTCTCACTCCTACCCAAGCTCTCAGCCAGCAAATGGACCTCCACAGCACACGGAACACGGCATCTACTGTGTCT

TTGATCTGTAGATCTTTTTTGTCTTTACCTGACTGTCACACATCCTTCAGCCCTGAAATTGAATTTTATGTGTACTGAGAAGATTTCCATGATTACCCAC

CACCCTGCCCATGACACTGAGTTACCTGCCATTCTTAATGTTTCTTACCCATCATGGCACTCATCGTACTGCATTGTAATTGCCTGTGTACTTGTCTATA

AACTACTAGACTGTCAGCTCCTTGAGGGCAGGGACTGTGTCTATTTTGTTCACAGTTGTATCCCCAGCACCCAGCACAGTGCCTGGCATATTGTAGGTGC

TTAATAAATATTTGTTGAATGAAA
Translation
 MRIICRQIVLLFSGFWGLAMGAFPSSVQIG - UNI30565 - GGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDNIETANSFAVTNAF 

- UNI30565 - - UNI32954 - FCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVF

LYDTDRG - UNI30565 - - UNI32954 - GYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQ - U

NI32954 - IVSVGKHVKGYHYIIANL GFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPK YTSALTYDGVLVMAETF

RSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQ VRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRK VGYWNDMDKLVLIQDAPTLGNDTA

AIENRTVVVTTIM - UNI30750 - ESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYG - U

NI30750 - - UNI36866 - KAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFS

PYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPR - UNI30750 - - UNI36866 - RSLSGRIVGGVWWFFTLIIISSYTAN

LAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFR - UNI36866 - RSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLE

STMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLR RTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDSGSK DKTSALSLSNVAGVFYILVGG

LGLAMLVALIEFCYKSRAEAKRMK LTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASDLP

For any suggestions or comments, please send an email to unitrap@crg.es