Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025898 (Cwf19l2)
Chromosomal location
Chr 9: 3404085 - 3479236 (+)
Description
CWF19-like 2, cell cycle control (S. pombe) Gene [Source:MGI Symbol;Acc:MGI:1918023]
RefSeq_dna
NM_027545 
RefSeq_peptide
NP_081821.1 
UniGene
Mm.245482 
MGI
MGI:1918023 
Uniprot/SWISSPROT
Q8BG79 
Human Ortholog
ENSG00000152404 (CWF19L2)
Omim not available
UniTrap UNI2107
Vector Insertion
Chr 9: 3418776 - 3421285
Public Clones AK0514 (sanger) AK0510 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5617
Vector Insertion
Chr 9: 3421377 - 3428667
Public Clones YTA321 (baygenomics) YHD007 (baygenomics) IST10494E1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10451
Vector Insertion
Chr 9: 3431088 - 3441054
Public Clones (sanger) D096D05 (ggtc) D058H03 (ggtc) FHCRC-GT-S9-6A1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34073
Vector Insertion
Chr 9: 3441146 - 3442960
Public Clones (sanger) IST13016H6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7602
Vector Insertion
Chr 9: 3450152 - 3454539
Public Clones RRR447 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32252
Vector Insertion
Chr 9: 3460132 - 3475482
Public Clones (sanger) IST13650E8 (tigm) IST10618F11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027027
Sequence
GACGGCAACAACTATGGAGGCGTTTAGTGTAAGATTTGAAAGTGCTAGCAGTATCGAAGAGCGAAAAGAACAGACCCGTAATGCCAGGGCCGAGGTGTTA

CGCCAG GCCAAACATAATTTTGAGAAAGAACAAAGGGGTGAAGAACGTAAGCGACTTCGGGATGAGGACACATGGATGCTTCCTGATGTGCATGAGCGA

ATTGAACAGTTCTCACAG GAACATTCTGAGAAGAAAAAGAAGAAAAAGGACAAGCATTCAAAAAAAGTGAAGAAAGAGAAGAAGAAGAAGAGGAAGAAA

CAGAAATGTCAGAAACAGAGTGAGTCGACTGACAGCTCCGCA AGCTCTGAAGATGAGTGGGTTGAGGCTGCTCCCTCCCAGATATCTGACAAAGAAAAG

ACCTGGAAAGTGAAAGACAAAAGGACAGAAGAAGAATGTGACAGCCACGATATTCAG CGTGATGAGTGGATGACTATTGATTTTATGTCCATTAAAACT

GTGTCCTCATCATCACTCAAAGCTGAAAAGGAAACTCTAAGACAAATAGAGCGGGAGAAAACCCAAGTGTTAGAGCAG - UNI2107 - TCCAAACTG

CTCGAAAGAGAATTGAATCCATACTGGAAGGACGGGGGGACAGGTCTCCCATCAAAAACCTGTATACTTCCAGTTACTAAAG - UNI5617 - CTAAA

GGAGTGGAGGATGGCGGATTAAGCTGGCTAAGAAAGTCTTGTCAAAGAATGAAGGAACAAGCTCAAAAAGAAAACAGAAATTTTGAAGATATTGTAGCTG

AAAAATACGGG TCAATGGAAATATTTCAGTCAAAATTAAAAGAAGCTGAAAAAATTGCATACAAAAAAGAAGACTGTGGATGGGAACGGTGGAGAAAGC

CTACATATTCAGATAGAGCACAGTGTAGTCAAGCAAGTGGCACATCAGACTTAGTGAAATGTAAAAATCTCTCAGAGGACAGACACCTGGAAATGGAGCC

AGCAAATAGCAGCAACTATAAGTTTAGTGGTCCTGACACAGGGAAGAGATCTGGGACTTTACAAACCTGTAGAAGGGAATCTGCCCTAAGAAAAAACCAA

GATTCTTCTGGAAATTTGAGATCTAAATTCTTAAGACCCTCTGATGAAGATGAATTGTCATTTCACAAGAGGAAAAATTTTGAATCATCTAGTTCATATT

CTCCATTAGTGGCTCAGGCTTCTTTGCATTGTGACTTTCGAAAACTCACAGAGAACAGTGAAGAAAGTTCAGCATCCTGCAGTCGATCTGATAGGCGACA

AGAAAACAGGAAGCCTTCAGATAAAAAGCCATTGGAAACCTGGAGCTACAACGCCAACCAGCACTCTACAGGAGGTAGAAGAGAACAGTTACAGGCTGAG

AGCATGAGTTGTGATCCACCAGGAAGAGGACTTCAGCAAGACATGACATTGACAATCGCTGG - UNI10451 - TCCAGAGGCAGAGTCCACCTATAT

CTTAAATGTTGATGAAAAGAACAAGTTGGGGGCCAAGATTATCAAGGCAGAAATGATGGGGAATATG - UNI34073 - GAATTAGCTGAACAACTTA

AAGCCCAACTTAAAGAGGCAAATAAATTTAAAGAAACACAGATGCCGGCAAAAAGATTGGGCGTAGAG CATGAAGATGAACAAGAAGTAATCCTTATTC

AAACAGATAAGTCTGGAAGAATGTGGCCTGTGAGCAGCCCTAGAGAAACCCTGGATATGAAAGCAGAACGAAGGAAGAGAAAGAGA GTTTCAACCCATG

AGGATAAAGAAAGGGTCCGATACTTTCCTGATGATGATCATTTGAGCCTCAAAGATTTAGTCAAGAATGAGAAAATAGGAACAGATATCAACCAAAACAG

ACTTTTCATGAAAATGGCATCTAAG - UNI7602 - TTTATGGGAAAATCAGATGAAGACAATTATACTCTGGATGACATGTTTGTCTCCAAAGCAGC

TGAGAAAGAGCATCTTGGTAAGAAGGAAGAGAGCCAGAGGAGAAGAGCGATTGCTGAGCACCAGAGTCTTGCTGCAAAAATGGCAAAGTGCCTTTACTGT

TTTGACAGCTCTCAGTTCCCCAAGCACCTTATTGTTGCAATCGGTGTGAAG GTTTATTTATGTTTACCCAGTTTCCAGTCTCTTACTGAAGGACACTGC

TTCATAGTCCCTCTGCAACATCATCAAGCAGCCACTGTATTAGATGAAGATGTCTGGGAGGAGATCCAG ATGTTTCGAAAATCATTGGTAAAAATGTTT

GAAGATAAAGAATTGGATTGTATCTTTTTGGAGACTAATATGGGTTTGAAGAAACACTATCATATGGTTTATGAGTGTATCCCTCTCCCAAAGGAAGTGG

GTGATATGGCTCCCATCTATTTTAAG AAAGCCATAATGGAATCTGATGAAGAATGGTCCATGAATAAGAAGTTGATTGATTTGTCTTCAAAAGATATTA

GAAAGTCT - UNI32252 - GTGCCCAGAGGTTTGCCTTACTTTGCTGTCGACTTTGGTCTTCAGGGAGGTTTTGCCCACATCATTGAAGATCAGTAC

AGATTCCCTCATTACTTTGGAAAG GAAATCATTGGTGGTATGCTGGATCTAGAACCTAGACTATGGAGGAAGGGGATCCGAGAAAGCTTTGAGGACCAG

AGGAAGAAATCATTGCAGTTTGCTCAGTGGTGGAAACCATATGATATCACCAAAAGTAAAAGCTCTTAAGTGTAGGTTATGTTTCATTTTCTATGCTGAA

CCCATTCAGTTTATGTCTATTATATTTACAAACAACTGTGCTTTGGGCTCTAGGGAAAGCAGCAGCAGCAGCAGCTGGCCACTCTAGTCACTGACAGCCA

TATTAGGTCAAGCTGTTTTCTTCCTCATGGTTCCTGGAAACATGGTTTGGGTGACTGTGGAGTAAGAACAACTGTATCAATATTATGGGCTCACATTTCA

TTCTGTGTCTACTAGATGTACCAAATTACTCAGTTACTCTAGAGATGGACTTGTTTCTAGAGGTCTAGCAAGGCTACAGGGGAAAGTGTGTCTGCTTCCA

GGTAGAGTCTGCCATCTAGGTTCTTTTGTGCTTTTTAAACAAGACTGGATGTATTCAGTACTAATTGGAAGTTTATTTTCATAGTTTCATGGAAGAGTTT

CTTTACTAATAGCATATAGTATCACTATGTACTATCTTGGTTTAAAGAAAAGGATTAAAGAATTAAATGATAAGGAAAATATTCATAAATACAAACTTGT

TTGTTCTAGACCTTGAAATAGTCTGAATTTTGGTAATCATAAAAACAGTTGTTCTAAATAACACAATTTTCATTTGTTTGTAGTTCATGTAAATGTAGCC

AAATTACTGTATTGGGATTGTAATGTCTCAAATGTTAAAGTAAATGTCCAGGAGATGTTCTGTTGTTCCAACTTGATTAAAGGTACTTAAGTTTTACTGT

TCTCAACATTTGATCTTGAGAAAAGCTTGGTTTTATAAAATATGAATTGTATTCTTTTTAAACATGCTTTTAAAAAACCAAATGTTTTGTTAATGCCTAG

ATAAAGGATGCCACAGACTAACTCATTACATGTTTATTTTAATGTCAGGTTGTCAATGTTTCCATGTATGTTGTTTGTATGTTACAAAGGCAACTGTTCT

TTTTTCAAATTTCACAAATGTATTGAAGCTTAATAGCTTTAACTTTCAATACTTATAAATTATATCTAAATGTGTATGTACATATAGTAAACAGGTGAGA

TGACTATTATAATCTTTTCAGCTATTGGATTTGCCACAGTCTTATATTCATTTTTATAATTAGTGAGTTAAAATATTTGTGATTACAGAGTGCTATGTTA

TGTTGATAGTTAAAAAATTATAAATACTCCTGCCTCAAAGTCTACTGAATCTGTAGCATTTCTGTCCCACCTCTGCTTTTGTCCTGGTTCCAGTTACTTG

TTGATGCACACTCAATTTCTCAAAACTTCTATTATTTGTAATAGT
Translation
MEAFSVRFESASSIEERKEQTRNARAEVLRQ AKHNFEKEQRGEERKRLRDEDTWMLPDVHERIEQFSQ EHSEKKKKKKDKHSKKVKKEKKKKRKKQKC

QKQSESTDSSA SSEDEWVEAAPSQISDKEKTWKVKDKRTEEECDSHDIQ RDEWMTIDFMSIKTVSSSSLKAEKETLRQIEREKTQVLEQ - UNI210

7 - SKLLERELNPYWKDGGTGLPSKTCILPVTKA - UNI5617 - AKGVEDGGLSWLRKSCQRMKEQAQKENRNFEDIVAEKYG SMEIFQSKLKEA

EKIAYKKEDCGWERWRKPTYSDRAQCSQASGTSDLVKCKNLSEDRHLEMEPANSSNYKFSGPDTGKRSGTLQTCRRESALRKNQDSSGNLRSKFLRPSDE

DELSFHKRKNFESSSSYSPLVAQASLHCDFRKLTENSEESSASCSRSDRRQENRKPSDKKPLETWSYNANQHSTGGRREQLQAESMSCDPPGRGLQQDMT

LTIAG - UNI10451 - GPEAESTYILNVDEKNKLGAKIIKAEMMGNM - UNI34073 - ELAEQLKAQLKEANKFKETQMPAKRLGVE HEDEQE

VILIQTDKSGRMWPVSSPRETLDMKAERRKRKR VSTHEDKERVRYFPDDDHLSLKDLVKNEKIGTDINQNRLFMKMASK - UNI7602 - FMGKSDE

DNYTLDDMFVSKAAEKEHLGKKEESQRRRAIAEHQSLAAKMAKCLYCFDSSQFPKHLIVAIGVK VYLCLPSFQSLTEGHCFIVPLQHHQAATVLDEDVW

EEIQ MFRKSLVKMFEDKELDCIFLETNMGLKKHYHMVYECIPLPKEVGDMAPIYFK KAIMESDEEWSMNKKLIDLSSKDIRKS - UNI32252 - V

PRGLPYFAVDFGLQGGFAHIIEDQYRFPHYFGK EIIGGMLDLEPRLWRKGIRESFEDQRKKSLQFAQWWKPYDITKSKSS

For any suggestions or comments, please send an email to unitrap@crg.es