Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025899 (Alkbh8)
Chromosomal location
Chr 9: 3335478 - 3387050 (+)
Description
alkB, alkylation repair homolog 8 (E. coli) Gene [Source:MGI Symbol;Acc:MGI:1914917]
RefSeq_dna
NM_026303 
RefSeq_peptide
NP_080579.1 
UniGene
Mm.116968 Mm.402002 
MGI
MGI:1914917 
Uniprot/SWISSPROT
Q80Y20 
Uniprot/SPTREMBL
Q3V2N8 Q8BY60 Q9D4T6 
Human Ortholog
ENSG00000137760 (ALKBH8)
Omim not available
UniTrap UNI37708
Vector Insertion
Chr 9: 3335595 - 3338455
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3898
Vector Insertion
Chr 9: 3338592 - 3343014
Public Clones AW0070 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5820
Vector Insertion
Chr 9: 3344720 - 3345780
Public Clones CSH611 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31432
Vector Insertion
Chr 9: 3349491 - 3359483
Public Clones IST12572E7 (tigm) IST14598G8 (tigm) IST10267G10 (tigm) IST12308B12 (tigm)
IST14860A9 (tigm) IST10536D5 (tigm) IST12291D6 (tigm) IST11186F9 (tigm)
IST10294C5 (tigm) IST10787E1 (tigm) IST13914F10 (tigm) IST14541A4 (tigm)
IST10409F5 (tigm) IST13434A7 (tigm) IST12685B11 (tigm) IST10387E8 (tigm)
IST10349A9 (tigm) IST13682G9 (tigm) IST14452F6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7037
Vector Insertion
Chr 9: 3359591 - 3367863
Public Clones RRY122 (baygenomics) IST14143B9 (tigm) IST13651A2 (tigm) IST11553H10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34658
Vector Insertion
Chr 9: 3369915 - 3382693
Public Clones (sanger) IST11182E6 (tigm) IST11038A7 (tigm) IST13879H11 (tigm) IST10605F5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32550
Vector Insertion
Chr 9: 3382844 - 3385041
Public Clones IST10876D11 (tigm) IST10024G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000053407
Sequence
AGTACTATTGTCTGCAACATGGCGGCGTCCGGTTGAAAGGGTGTCAGAGCATAGGTGGTCAGGCTGCACCGGGGAAGGCTGGCGATTGACAAAGCAGCTG

GGAGGTGAACATTTCTG TATTACTATGAATATCAATCATAAAGGTGTTTTGAAACTCACTAAAATGGAAAAGAAGTTCTTAAGGAAACAGAGTAAAGCC

AGGCATGTGTTGCTGAAACATGAAGGCATCCAAGCAGTGTCTTATCCCACTCAG - UNI3898 - AGCCTGGTTATTGCCAATGGTGGTCTGGGTAAT

GGCGTGAGTAGGAAACAACTGCTTTTGACTTTGGAGAAATGTGGACCTGTGGAAGCTCTCCTCATGCCACCTAATAAGCCATATGCATTTGTAATATTCC

AAACTATTGAAGAATCCAAGAAAGCATATTTTACCCTCAATGGAAAAGAAATCATTGATGATTTGGGGCAGAAGATCTTTCTGTACTTGAATTTTGTTGA

AAAAG CACAATGGAAAAACATGGGCCTTGAAGCCTTACCTCCAGGCCTCTTGGTGGTAGAAGAAATTATTTCTTCTGAGGAGGAGAAAAAGCTTCTGGA

GAGTGTGAATTGGACAGAAGATACAGGCAATCAGAATT - UNI5820 - TTCAAAGGTCCTTAAAACACAGAAGAGTGAAACATTTTGGCTATGAATT

TCACTATGAGAGCAACACTGTGGATAAAGACAAGCCCTTACCTGGGG GTCTTCCTGAGGTTTGCAGTAGCATTTTGGAGAAGTTGTTGAAAGAAGGTTA

TATTAAACATAAACCAGACCAGTTGACCATAAATCAATATGAACCTGGGCATG GAATTCCTGCCCATATTGACACGCATTCTGCATTTGAAGATGAGAT

TATTTCTCTCAGTTTGGGGTCAGCG - UNI31431 - ATTGTTATGGATTTCAAGCATCCAGAGGGTGTCACAGTACAAGTTATGTTACCTCGTCGGA

GTTTGCTGGTGATGACAGGAGAATCTAGATACCTTTGGACTCATGG - UNI7037 - AATTACACCTCGAAAATTTGATACCGTCCAAGCGTCTGAGC

AATTTAAAGGGGGAATAATCACCAGTGACATTGGAGACTTGACTTTAAGCAAGAGGGGAATGCGCACATCCTTTACGTTTAGAAAAGTGAGGCGAATGCC

CTGCAATTGTA GTTACTCCTCAGTCTGCGACAGACAAAGGAAGGCCACACCTCCATCCCTTACAGAGAGCAGTAAAGAAGCATTGGAGTTAGAGCAAAA

GCATGTCCATCAAGTGTACAATGAGATTGCAAGTCACTTCAGCAGCACAAGACATAGCCCATGGCCACGCATAGTAGAGTTCCTGAAAGCTTTGCCAAGT

GGTTCCATAGTGGCAGATATCGGATGTGGAAATGGAAAATACCTTGGCATCAACAAGGACTTATATATG - UNI34658 - ATTGGGTGTGATCGTAG

CCAGAACCTTGTGGACATTTGTAGAGAGAGGCAGTTCCAGGCCTTAGTCTGCGATGCGCTGGCTGTTCCTGTCAGAAGTGGGTCTTGTGATGCTTGCATC

TCTATTGCCGTCATTCACCACTTTGCAACTGCA - UNI32548 - GAGCGCAGAGTGGAAGCTCTCCAAGAACTTGCCCGTCTCCTGAGACCTGGTGG

GCAGGCCCTCATTTATGTCTGGGCAATGGAACAAGAGTATAAAAATCAGAAGTCCAAGTATCTTAGAGGAAAGAGAATTAGCCAAGGAGATAAAGATGAG

CTAAACAGTGCCACATCTACGGAAGAATTTCTAGTAAATCAAACGCCTGAGGGGGTCAATGAAGACCCAGCATTGTCTGTCAACTCCAGTAGTATCACCA

AGGAAGAAGAGTATAAGTCAAGGAAAGTTCCTAATTCTGAACTCCCTATTCATATAAATAGGACCTGCTTTCATTCCCAAGATGTGCTGGTTCCCTGGCA

CCTCAAAAGAAACCCTGGTAAAGACAAAGCTATTGAACCATCTGGTGTAGCAGGATGTCCTGACCCAAGTCCTGTGTTTCATCGTTATTACCATGTTTTC

TGTGATGGAGAATTGGAAGCTTCATGCCAGGCTGTGGGTGATGTTAGCATTCTGCAGAGCTATTACGATCAAGGGAATTGGTGTGTTGTTCTTCAAAAGG

TCTGATCACTTATCTGAACATATCATGTGTAAAGAGAAAAAAAAAAGTCAATCTCTTTTTGAAAAGGAAACTAAATTATCTCTTTAAATAAGGAGGAAAT

TTGGAACAGAGATACTTAGGAAACATTTTTCTCTATTCCCGTTGTCTGACTTCATAAACGTAGGTTCCTCTTACATGCCTTTTAAGTATGGTGTTTGACA

TTAACTTGTGAAAAGTCTGTGATGTTTGTATATATATAGCATTTGAAGATAAACTTTTGTGTTAAAATCTTTTTATAACTCCAACTTTTGTAGGGTCATA

TTGAAGCAATTATGTGAGATTTTAATGAAGTGAATATTCCTGGACAATAAGGAAGTATCTGAAGAGCTGGGTGTGGTGGCGCACACCTTTGATCCCAGCA

CTCGGGAGGCAGAGGCAGGCGAATTTCTGAGTTCAAGGCCAGCCTGGTCTACAGAGTGAGTTCCAGGACAGCCAGGACTACACAGAGAAACCCTGTCTCT

AAAAAACCAAACCAAACCAAACCAAACCAGAAAGAAAAAAACAAATATATATCTGAAGTTTTATCTGAAATTGTTTGTTCCAAAAAAAAAAAATTATACT

TTCTCACTGCATCTTGCTATTACATTCTGGATGCCTGCCCAGAAACACTTTAGCCAGAAGATTCTCAGTAATTAATAGAAATTTAATTCAACAGATACTC

ATTAAGCACACACCCTATACTGAGTAGTATTAAATACTAGGAGTGAAGTTGTAAACAAGTAAAAGAGGTTGGGGTGTAGATGAATTGAAGAACCTATGTT

TGTCATTGAAGCTCTAGATTTAGTACTGATTACCACAAACACAGACAAACCAGCAGGAAACAAGAACGAAGTACCTAGGGAGCTGACCTTCAAGAAGGGA

TGGCTGGTACAAGCGAACAAATAAGTAAACATGGTGTGTGTGGTGATCATAAATGCCATGTAAAGAGTATAAAAGTCTTTGAGCAAAAGATTACTTTTCA

ATGGCAAAAATAACTACTAATCCCGACTAATTTATTACCAGAAATTACTATTCCTGATCCATTTGTCTAAGCTCTAAACACAACTCTAATAGTTTCCTTG

AACAGTTAAATTGCAAAAGTTAAAATGTTTTCAGTGAAACCAAACATTGTTCTTGCAGTCACAGTTGGCTGTTTCTTACTCACAGTTTGTCTCAGTTCAG

GACAGGGGTTGCATTTTTATCTAGTCAGTGAAACCAAAAGCATGTTCTTGGAAAGTATTAGTAAAATTGATGAATATCTACCCAGACTGAGTATACCAGG

GGGAAATTTTTGTGATTTTTGTAATTGCCTCAATTAAAAAAAATAATTAAAAATAACATGTAAATGTTTTAAAACCATCATGTTCTTTAAAAAAATGTTT

ATAATGAACAATTTTTAAAATTGTAGTAGGATTTTTTAAAAATTCTATTTGCATAT
Translation
 MNINHKGVLKLTKMEKKFLRKQSKARHVLLKHEGIQAVSYPTQ - UNI3898 - SLVIANGGLGNGVSRKQLLLTLEKCGPVEALLMPPNKPYAFVI

FQTIEESKKAYFTLNGKEIIDDLGQKIFLYLNFVEKA AQWKNMGLEALPPGLLVVEEIISSEEEKKLLESVNWTEDTGNQNF - UNI5820 - FQRS

LKHRRVKHFGYEFHYESNTVDKDKPLPGG GLPEVCSSILEKLLKEGYIKHKPDQLTINQYEPGHG GIPAHIDTHSAFEDEIISLSLGSA - UNI314

31 - IVMDFKHPEGVTVQVMLPRRSLLVMTGESRYLWTHG - UNI7037 - GITPRKFDTVQASEQFKGGIITSDIGDLTLSKRGMRTSFTFRKVRR

MPCNCS SYSSVCDRQRKATPPSLTESSKEALELEQKHVHQVYNEIASHFSSTRHSPWPRIVEFLKALPSGSIVADIGCGNGKYLGINKDLYM - UNI3

4658 - IGCDRSQNLVDICRERQFQALVCDALAVPVRSGSCDACISIAVIHHFATA - UNI32548 - ERRVEALQELARLLRPGGQALIYVWAMEQ

EYKNQKSKYLRGKRISQGDKDELNSATSTEEFLVNQTPEGVNEDPALSVNSSSITKEEEYKSRKVPNSELPIHINRTCFHSQDVLVPWHLKRNPGKDKAI

EPSGVAGCPDPSPVFHRYYHVFCDGELEASCQAVGDVSILQSYYDQGNWCVVLQKV

For any suggestions or comments, please send an email to unitrap@crg.es