Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025907 (Rb1cc1)
Chromosomal location
Chr 1: 6204743 - 6265656 (+)
Description
RB1-inducible coiled-coil 1 Gene [Source:MGI Symbol;Acc:MGI:1341850]
RefSeq_dna
NM_009826 
RefSeq_peptide
NP_033956.1 
UniGene
Mm.293811 Mm.467912 Mm.471724 
MGI
MGI:1341850 
Uniprot/SWISSPROT
Q9ESK9 
Uniprot/SPTREMBL
B2RX00 Q6NZG0 
Human Ortholog
ENSG00000023287 (RB1CC1)
Omim not available
UniTrap UNI21564
Vector Insertion
Chr 1: 6205039 - 6218020
Public Clones E068G08 (ggtc)
Private Clones OST325935 (lexicon) OST207571 (lexicon) OST117003 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027040
Sequence
CCGAGTCGACAATAACAAACCCCACGGCGGCCGCGACCCAGCCCTGCCAAGCTCTCAGTGCCTCGGCCGGCGGACTCGGGTCCCCGCGCGGAGCCGAGGG

GCCGGAGCAGCGGCTGCGCCCGACTCCCATCCTTCCGGGCCTCGCCGGGTACTCGGCGGCTGGGCGCCGACGGTTGTGTCGGTTGGCGGCGCCGCAGGGG

CGGTTGATAGCCGCCGCCGAGGCCAGGGCGGCGGCAGAAGATGGTGCGGAGGGCCGCCGGCTGTGTTGCTGCCGCGGGCGGAGGAGGCGCTGCCGG - U

NI21564 - TTCTCTGAGTTTCACCAGTAATGCCACTCAGTTGCCAATATCAAGCAAGCGCATATAAGACACTTGTAATCTTTTAAGAAAAGTAGTACT

TCTCTTCACAGTATCTGGCG GATCAACACTGGAGGGTGAGGTGTCAGCTTCCAGAAAGATCATCATGAAGTTATATGTGTTTCTGGTTAACACCGGAAC

CACGCTGACATTTGACACTGAGCTAACTGTGCAAAC TGTGGCTGATCTTAAGCATGCCATTCAAAGCAAATACAAGATTGCTATTCAGCACCAGGTTCT

GGTGGTCAATGGAGGAGAATGCATGGCTGCAGATCGAAGAGTGTGTACTTACAGCGCTGGGACG GACACAAATCCAATTTTTCTTTTTAATAAAGAAAT

GATCTTATGTGACCGTGCACCTGCTATTCCTAAAGCTACCTTTTCAACAGAAAATGACATGGAAATAAAAGTTGAAGAGTCTCTTATGATGCCTGCAGTT

TTCCACACTGTTGCTTCAAGGACACAGCTTGCAGTG GAAATGTATGACGTTGCCAAGAAGCTCTGCTCTTTCTGTGAAGGGCTTGTCCATGATGAACAT

CTTCAGCACCAAGGCTGGGCTGCAATCATGGCCAATCTGGAGGACTGTTCAAATTCATACCAAAAACTTCTTTTCAAGTTTGAAAGTATTTATTCTGATT

ATCTTCAATCCATAGAAGACATCAAGTTAAAACTTACTCA TTTAGGAACTGCTGTTTCAGTAATGGCCAAGATTCCACTATTGGAGTGCCTAACCAGAC

ATAGTTACAGGGAATGTTTGGGAAGACCGGATTCTTTGAATGAACATGAAGGCTCAGAGAAAGCTGAGATGAAAAGATCTACTGAACTGGTGCTCTCTCC

TGATATGCCTAGAACAACGAACACATCCTTGGTAACCTCATTTCACAAGTCAATGGAGCATGTAGCTCCAGATCCCACCGGTACTGAACGTGGCAAAGAA

CTTAGGGAATCTTGTCAAAGTACTGTCCAGCAAGAAGAAGCTTCAGTGGATGCTAAAGACAGTGATCTGCCTTTTTTTAATGTTTCTTTGTTAGACTGGA

TAAATGTTCAAGATAGACCCAATGATGTGGAATCTCTGGTCAGGAAGTGCTTTGATTCTATGAGCAGG CTTGACCCAAAGATTATTCAACCATTTATGT

TAGAATGCCATCAAACTATTGCCAAACTTGATAATCAGAATATGAAAGCCATTAAAGGGCTTGAAGATCGGCTGTATGCCTTGGACCAGATGATTGCTAG

CTGTAGCCGGCTGGTAAATGAACAGAAAGAGCTTGCTCAG GGATTTTTAGCTAATCAGATGAGAGCTGAAAACTTGAAGGATGCATCTGTGTTACCTGA

TCTGTGTCTGAGTCATGCAAATCAACTAATGATTATGTTGCAAAACCACAGAAAACTGTTGGATATTAAACAGAAGTGCACCACTGCCAAACAAGAGCTA

GCAAACAATCTCCACGTCAGACTGAA GTGGTGTTGTTTTGTGATGCTTCATGCTGATCAAGATGGAGAAAAACTGCAGGCACTGCTCCGCCTTGTAATA

GAGCTGTTAGAAAGAGTCAGAATTGTTGAGGCTCTTAGTACAGTTCCTCAGATGTATTGCCTAGCTGTTGTTGAGGTTGTAAGAAGAAAAATGTTCATTA

AACACTACAGAGAG TGGGCTGGTGCTTTAGTCAAAGACGGAAAACAACTATATGAAGCTGAAAAGTCAAAAAGGGAATCCTTTGGGAAATTATTTA GG

AAGTCCTTTTTAAGAAATCGTCTGTTTAAAGGACTGGACTCCTGGCCTTCCTCATTTTGT ACTCAGAAGCCTCGAAAATTTGACTGTGAACTTCCAGAT

ATATCATTAAAAGATTTACAGTTTCTTCAATCATTTTGTCCTTCAGAAGTGCAGCCATTCCTCAG GGTCCCCTTACTTTGTGACTTTGAACCTCTACAC

CAGCATGTACTTGCCCTACATAATTTGGTAAAAGCAGCACAAAGTTTGGATGAAATGTCACAGACTATTACAGATCTCCTAAATGAACAAAAG GTATCC

ACAAGTCAGGCATCCCCACAGTCAGCTGCTTCTCCAAGAATAGAAAGTACAACAGGCATTACAACCACTACCTCACCAAAAACTCCTCCTCCACTAACTG

TTCAGGACACCTTATGTCCGGCAGTGTGTCCCTTAGAAGAATTATCTCCAGATAGTATCGATGCTCATACATTTGATTTCGAAACCATCTCCCATCCAAA

CACAGAACAACCTGTTCACCAAGCTTCTATAGACTTGGATTCATTAGCAGAAAGCCCTGAGTCTGACTTTATGTCTGCTGTGAATGAGTTTGTGATAGAA

GAAAATTTATCGTCTCCAAACCCTATAAGTGATCCACAAAGTCCAGAAATGATGGTGGAGTCACTTTACTCTTCAGTCATCAATGCAATAGATAGTAGGC

GTATGCAAGACACAAGTACACGTGGAAACGAGGGCTTTGGGGATCGGGCTGCTCTACATGTCCAGCTGGAGAAATGCAGAGCTGCTGCACAAGACTCTCA

CAGCAGTATACAAACCATCAAGGACGATCTGTGCCATTTCAGAACATTTGTACAAAAAGAACAGTGTGACTTAGCAAATTATTTAAAATGTACAGCTGTA

GAAATAAGAAATATTATTGAAAAAGTAAAATGTTCTCTAGAAATAACACTAAAGGAAAAGCATCAGCAAGAACTCCAATCTTTAAAAATTGAGTATGAAT

GTAAACTTGATGCTCTAGTAAAAGACAGTGAAGAAAATGTAAATAAAATTTTAAAATTGAAAGAAAATTTAGTATCCCTTGAAGAGGCTTTACAAAATAA

AGACAATGAATTCACTTCGATTAAACATGAAAAGGATGCTATTGTCTGTGTGCAGCAAGAAAAGGATCAGAAGTTGTTAGAGATGGAAAAGATAATGCAT

ACTCAACATTGTGAAATTAAAGAACTGAAGCAGTCACGAGAGATGGCATTAGAAGACCTGAAAAAGCTGCATGATGAAAAAATCGAGTCATTGAGAGCTG

AATTTCAGTGCTTAGAACAAAATCACCTGAAGGAATTAGAGGACACACTGCACATCAGGCACACACAGGAGTTTGAGAAAGTTATGACAGACCACAATAT

GTCTTTGGAGAAATTAAAAAAAGAAAATCAGCAAAGAATTGACCAGATGCTAGAATCTCATGCCTCAACTATTCAGGAAAAAGAGCAACAGCTGCAGGAG

TTGAAACTCAAAGTTTCTGACTTGTCAGACATGAGATGTAAGTTAGAGGTTGAACTTGCACTAAAGGAAGCAGAAACAGATGAGATAAAGATCTTGTTGG

AAGAGAGCAGAACACAGCAGAAGGAAATGCTGAAGTCTTTACTTGAACAAGAGACCGAAAACTTAAGAACAGAAATAAGTAAACTAAACCAAAAAATTCA

TGATAATAATGAGAGTTACCAGGTGGGTTTGTCAGAGTTAAGAGCTTTAATGACAATTGAAAAAGATCAGTGCATTTCAGAGTTAATCAGTAGACATGAA

GAAGAATCTAATATACTTAAGGCTGAATTAGACAATGTTACATCTTTGCATCGCCAAGCATATGAAATAGAAAAAAAACTGAAAGAACAAATAGTTGAAT

TGCAGACTAGATTGAACTCAGAATTGAGTGCTCTTGAAAAACAGAAAGATGAAAAAATAACCCAACAAGAAGAGAAGTATGAAGCACTTATCCAGAACCT

TGAGAAAGACAAGGAGAGACTGGTCAAGAACCACGAGCAAGACAAAGAACACTTAATTCAGGAGCTTAATTTTGAAAAAAACAAAGCTGTTCAAACTGCA

CTAGATGAATTTAAGGTGGAGAGAGAACTTGTTGAGAAAGAGTTATTAGAAAAAGTTAAACATCTTGAGAATCAAATAGCCAAAAC TCCTGCCTTTGAG

TCAGCCAGAGAAGATTCTTCAAGCTTAGTTGCGGAACTTCAAGAGAAACTTCAAGAAGAAAAAGCTAAGTTTCTGGAACAACTTGAAGAACAAGAGAAAA

GAAAGAATGAGGAAATGCAAAATGTCAGAACCTCTTTGATTGCTGAGCAGCAG ACCAACTTTAACACAGTCTTAACAAGAGAGAAAATGAGGAAAGAAA

ACATAATAAATGATCTTAGTGATAAGCTAAAAAGTACAATGCAGCAGCAAGAGCGGGATAAAG ATTTGATAGAGTCGCTCTCTGAGGACCGAGCTCGTT

TGCTTGAAGAGAAGAAGCAGCTTGAAGAGGAAGTGAGTAAACTCCGCACTAGCAGTTTTCTTTCCTCAGCACCTGTGGCTGCAGCCCCAGAGCTCTATGG

TGCGTGTGCACCTGAGCTCCCAGGGGAGCCAGAGAGATCAGTCATGGAGACGGCAGATGAAGGAAGACTGGATTCCGCAATGGAGACAAGCATGATGTCT

GTCCA AGAAAACATGTTATCTGAAGAGAAGCAGAGGATCATGCTCCTAGAACGG ACATTGCAGTTGAAAGAAGAAGAAAACAAGCGGTTAAATCAAAG

ACTG ATGTCTCAGAGTTTGTCCTCAGTCTCTTCAAGGCATTCTGAAAAAATAGCCATTAGAGA TTTTCAGGTGGGAGATTTGGTTCTCATCATCCTAG

ATGAGCGGCACGACAATTATGTATTGTTTACTGTTAGTCCTACTTTATATTTTCTGCACTCAGAGTCTCTTCCTGCCCTGGATCTCAAACCAGGTGAGGG

AG CTTCAGGTGCATCTAGAAGACCCTGGGTCCTTGGGAAAGTAATGGAAAAGGAATACTGTCAAGCCAAAAAG GCACAAAACAGATTTAAAGTTCCTT

TGGGGACAAAGTTTTACAGAGTGAAAGCTGTGTCATGGAATAAGAAAGTATAGCCACAGAAGAAATCTCTACATCTCATACCATTTTTGATTTGTCCTCC

AGTGCTGATAAACTACTCTAAAAACAGCTGGCCATTGTTGGGTTTTTTTTTGTTGTTTGTTTGTTTGTTTGTTTTTACAAAAGTCAACATAACAATATAC

TTCATTGGTGGACTGCACTTACCTTTTAAGTGGCTACATCTTAGGAACAATAAATTTATTAAAATTCTTGGCTGAATCAAAATGGTTTTGTTTTGTTTCC

ACCCAAATAACTAGAAATTCGGACCAAAATAGATGTTTTCCAAGGGCAGAGCCTGCACTGTGGCTTGTGACTAGCCTCATTAGTTGCCTGTTAATAAACA

TTAGCTGAATAGTTACCAGTGTTGTTACCAGCATTTGTCCTCTTGTGAATTCAAGAGTCCTCGCACTCTTTAACATGTTCTTTATAAAATGTATAAACCC

TTCCAAACTATTTAAAGAGGAGTGTTATTGCATGCAGATAATCATAATTTTGAGTTTGCCTCAGAAGACTACTAAAGCAAATTTGTTCATTTTTTTTTAA

AAAAATGCCCTTTAATGTTTCAAAAAAAAATAACAGTGTAATTTGACTGACTTTAAGATCAGCCATAAATAATGAGCAGTCTTCAAAAGCACTTTTCACA

CAGATCATCTGGGCTCCAGGGAGGAAGAGTCTGTGCCACTGATGTTTTCAAGTGCAGGACTCACTCAAACCTCTCAGCATCTTAGGACTGTTTCAAGTAA

TCATATTGATGAACTCGTAATTCATGGTTGACCTTCAGAAGAAGATATTCATTGTATATTAACATTTAGAGGTCATTTAAATAACAAAAGTCTGTATTGT

AAAGGACCTGTACAATTTTAAGACAATAAAGAATTGAAAGTGTAAATGTGTGTGCCTTTTAAAGGTTACATTTTAAATATATTGCGTGATTTCTGGGAAA

GGTGAAAAAAATGTTCTGTATCAAAGAGAAACCTGTTTATTAAAAAATGTTGTTTGTATCCTATGTAACAGGGTGAAGTGGTGTTCTGTGGAACAGAACC

ATGTAAACTCAAGGTTTAAAAGCTGGCACTGAACAAAGATATTGAAGTAGCTAGGCTAGTTGATTGGAAAGAGTTTCTTCAGGGTTGTTGTTAGCAGTAA

TAAATGATTCTTTTTCAGAAATATTTAATTTCTCCATAAAAATAAGTTGGATATTTTTATAAATATGTAATCTAATAGAATGAAAATGGAATAAACATAG

TGTATAGAATACCTAATTCAAAAACATATTAATGAATAAACGAACAAATGATT
Translation
 - UNI21564 -  MKLYVFLVNTGTTLTFDTELTVQT TVADLKHAIQSKYKIAIQHQVLVVNGGECMAADRRVCTYSAGT DTNPIFLFNKEMILCD

RAPAIPKATFSTENDMEIKVEESLMMPAVFHTVASRTQLAV EMYDVAKKLCSFCEGLVHDEHLQHQGWAAIMANLEDCSNSYQKLLFKFESIYSDYLQS

IEDIKLKLTH HLGTAVSVMAKIPLLECLTRHSYRECLGRPDSLNEHEGSEKAEMKRSTELVLSPDMPRTTNTSLVTSFHKSMEHVAPDPTGTERGKELR

ESCQSTVQQEEASVDAKDSDLPFFNVSLLDWINVQDRPNDVESLVRKCFDSMSR LDPKIIQPFMLECHQTIAKLDNQNMKAIKGLEDRLYALDQMIASC

SRLVNEQKELAQ GFLANQMRAENLKDASVLPDLCLSHANQLMIMLQNHRKLLDIKQKCTTAKQELANNLHVRLK KWCCFVMLHADQDGEKLQALLRLV

IELLERVRIVEALSTVPQMYCLAVVEVVRRKMFIKHYRE WAGALVKDGKQLYEAEKSKRESFGKLFR RKSFLRNRLFKGLDSWPSSFC TQKPRKFDC

ELPDISLKDLQFLQSFCPSEVQPFLR RVPLLCDFEPLHQHVLALHNLVKAAQSLDEMSQTITDLLNEQK VSTSQASPQSAASPRIESTTGITTTTSPK

TPPPLTVQDTLCPAVCPLEELSPDSIDAHTFDFETISHPNTEQPVHQASIDLDSLAESPESDFMSAVNEFVIEENLSSPNPISDPQSPEMMVESLYSSVI

NAIDSRRMQDTSTRGNEGFGDRAALHVQLEKCRAAAQDSHSSIQTIKDDLCHFRTFVQKEQCDLANYLKCTAVEIRNIIEKVKCSLEITLKEKHQQELQS

LKIEYECKLDALVKDSEENVNKILKLKENLVSLEEALQNKDNEFTSIKHEKDAIVCVQQEKDQKLLEMEKIMHTQHCEIKELKQSREMALEDLKKLHDEK

IESLRAEFQCLEQNHLKELEDTLHIRHTQEFEKVMTDHNMSLEKLKKENQQRIDQMLESHASTIQEKEQQLQELKLKVSDLSDMRCKLEVELALKEAETD

EIKILLEESRTQQKEMLKSLLEQETENLRTEISKLNQKIHDNNESYQVGLSELRALMTIEKDQCISELISRHEEESNILKAELDNVTSLHRQAYEIEKKL

KEQIVELQTRLNSELSALEKQKDEKITQQEEKYEALIQNLEKDKERLVKNHEQDKEHLIQELNFEKNKAVQTALDEFKVERELVEKELLEKVKHLENQIA

KT TPAFESAREDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSLIAEQQ TNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKD DL

IESLSEDRARLLEEKKQLEEEVSKLRTSSFLSSAPVAAAPELYGACAPELPGEPERSVMETADEGRLDSAMETSMMSVQ QENMLSEEKQRIMLLER TL

QLKEEENKRLNQRL MSQSLSSVSSRHSEKIAIRD DFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGA ASGASRRPWVLGKVME

KEYCQAKK AQNRFKVPLGTKFYRVKAVSWNKKV

For any suggestions or comments, please send an email to unitrap@crg.es