Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000025982 (Sf3b1)
Chromosomal location
Chr 1: 55042016 - 55084323 (-)
Description
splicing factor 3b, subunit 1 Gene [Source:MGI Symbol;Acc:MGI:1932339]
RefSeq_dna
NM_031179 
RefSeq_peptide
NP_112456.2 
UniGene
Mm.279736 Mm.406476 Mm.409874 Mm.412798 
MGI
MGI:1932339 
Uniprot/SWISSPROT
Q99NB9 
Uniprot/SPTREMBL
A0JLN0 Q3UIB4 Q3US00 Q8C2Y9 
Human Ortholog
ENSG00000115524 (SF3B1)
Omim not available
UniTrap UNI5576
Vector Insertion
Chr 1: 55076245 - 55084182
Public Clones (sanger) RRS019 (baygenomics) CSI221 (baygenomics) CSI303 (baygenomics)
YTA222 (baygenomics) IST14975E12 (tigm)
Private Clones OST394972 (lexicon) OST147690 (lexicon) OST42668 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25671
Vector Insertion
Chr 1: 55073335 - 55073622
Public Clones not available
Private Clones OST170880 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6694
Vector Insertion
Chr 1: 55060335 - 55062645
Public Clones (sanger) BGC447 (baygenomics)
Private Clones OST27963 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38693
Vector Insertion
Chr 1: 55059947 - 55060335
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4908
Vector Insertion
Chr 1: 55055104 - 55056470
Public Clones AS0068 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27279
Vector Insertion
Chr 1: 55045000 - 55047146
Public Clones not available
Private Clones OST65168 (lexicon)
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027127
Sequence
AGTGCGGCGCGCGCTCCCGGGTGCGCACGCTCAGAGAGCGGCCTCTGTTTCTGGCGGCGGCGAGCGGAAGTCCTTGGGAGCGCCAGTTCCGTCTGTGTGT

TCGAGTGGACAAAATGGCGAAGATCGCCAAGACTCACGAAG - UNI5576 - ATATCGAAGCACAGATTCGAGAAATTCAAGGCAAGAAGGCAGCTCT

TGATGAAGCCCAAGGAGTGGGCCTTGATTCCACAGGTTATTATGACCAAGAAATTTATGGTGGAAGTGATAGCAGATTTGCTGGATATGTGACATCAATT

GCTGCAACTGAACTTGAAGAT GATGACGATGACTACTCATCATCCACGAGCTTGCTCGGTCAGAAGAAGCCTGGATATCATGCCCCCGTGGCGTTGCTT

AATGATATACCACAGTCAACAGAGCAG - UNI25671 - TATGATCCATTTGCTGAGCATCGTCCTCCAAAGATTGCCGATCGGGAAGATGAATACAA

AAAGCATAGGCGGACCATGATAATTTCCCCAGAGCGTCTTGATCCTTTTGCAGATG GAGGGAAGACTCCCGATCCTAAAATGAATGCTAGAACCTACAT

GGATGTTATGCGAGAACAACATTTGACTAAGGAAGAG AGAGAAATTAGGCAACAACTAGCAGAAAAAGCTAAAGCTGGAGAACTAAAAGTCGTCAATGG

AGCAGCAGCATCCCAGCCTCCCTCAAAACGAAAACGGCGCTGGGATCAGACCGCTGACCAGACTCCTGGTGCCACTCCCAAAAAGCTATCGAGTTGGGAT

CAGGCAGAG ACCCCTGGGCATACCCCATCTTTAAGATGGGATGAGACACCGGGTCGTGCAAAAGGAAGTGAAACACCTGGCGCAACCCCAGGCTCAAAA

ATATGGGACCCTACACCGAGTCATACACCTGCGGGAGCTGCTACTCCTGGGCGAGGCGACACACCAGGCCATGCAACCCCGGGCCATGGTGGTGCAACTT

CCAGTGCTCGTAAAAACAGATGGGATGAGACCCCCAAAACAGAAAGAG ATACTCCTGGGCATGGAAGTGGATGGGCTGAGACTCCTCGAACAGATCGAG

GTGGAGACTCTATTGGTGAAACACCAACTCCTGGAGCAAGTAAAAGAAAGTCTCGTTGGGATGAAACGCCGGCGAGTCAAATGGGTGGAAGCACTCCTGT

TCTGACTCCAGGAAAAACACCAATTGGCACACCAGCCATGAACATGGCTACCCCGACTCCAG GTCACATAATGAGCATGACACCTGAACAGCTTCAGGC

GTGGCGGTGGGAGAGAGAAATTGATGAACGAAACCGCCCACTTTCTGATGAAGAATTAGATGCTATGTTCCCAGAAGGATATAAG - UNI6694 - GT

ACTTCCCCCTCCAGCTGGTTATGTTCCTATTCGAACTCCAGCTCGAAAGCTGACAGCAACTCCTACACCTTTGGGTGGTATGACTGGTTTCCACATGCAA

ACTGAAGACAGAACTATGAAAAGTGTCAATGACCAGCCATCTGGGAATCTTCCATTTTTAAAACCTGATGACATTCAGTACTTTGATAAACTATTG GTT

GATGTAGATGAATCAACACTTAGTCCAGAAGAACAAAAAGAAAGAAAAATAATGAAGTTGCTTTTAAAAATTAAGAATGGTACACCTCCAATGAGAAAG 

GCTGCCTTACGTCAGATTACTGATAAAGCTCGAGAATTTGGAGCTGGACCACTGTTTAACCAGATTCTTCCTCTGTTGATGTCCCCTACACTTGAGGATC

AAGAGCGACATTTACTTGTGAAAGTTATTGATAGAATATTGTATAAACTTGATGACTTGGTGCGGCCGTATGTGCACAAG ATTCTTGTGGTTATCGAGC

CACTGTTGATTGATGAAGATTACTATGCTAGAGTGGAAGGCCGAGAGATTATTTCTAATTTGGCAAAG GCTGCTGGTCTGGCTACTATGATTTCTACCA

TGAGACCTGATATAGATAACATGGATGAATATGTCCGAAACACAACAGCTAGAGCTTTTGCTGTCGTAGCCTCTGCCCTGGGCATCCCTTCTTTATTGCC

TTTCTTAAAAGCTGTGTGCAAAAGCAAGAAGTCTTGGCAAGCGAGGCACACTGGTATTAAGATTGTACAACAGATAGCCATTCTCATGGGCTGTGCTATC

TTGCCACATCTCAGAAGTTTGGTTGAAATCATTGAACATG GTCTCGTGGATGAGCAGCAGAAAGTTCGGACCATCAGTGCTCTGGCCATTGCTGCTTTG

GCTGAGGCAGCAACTCCTTATGGTATTGAGTCTTTTGATTCTGTGCTCAAGCCCCTATGGAAGGGTATCCGCCAACACAGAGGAAAG GGTCTGGCTGCT

TTCTTGAAGGCTATTGGGTATCTTATTCCTCTTATGGATGCAGAATATGCCAACTACTATACTAGAGAAGTGATGTTAATCCTCATTCGAGAATTTCAGT

CTCCTGATGAAGAAATGAAGAAAATTGTTTTGAAG GTGGTGAAACAGTGTTGTGGAACTGATGGTGTAGAAGCAAACTACATTAAAACAGAGATTCTTC

CACCTTTCTTTAAACACTTTTGGCAACACAGAATGGCTTTGGATAGAAGAAATTACCGACAG - UNI4908 - TTAGTTGATACAACTGTGGAGTTGG

CAAACAAAGTAGGTGCAGCAGAGATCATATCTAGGATTGTTGATGATCTGAAGGATGAAGCTGAGCAGTACAGGAAAATGGTGATGGAAACAATTGAGAA

AATTATGGGTAATCTAGGCGCAGCAGATATTGACCATAAACTTGAGGAACAACTGATTGATGGTATTCTCTATGCTTTCCAAGAACAGACTACAGAG GA

TTCAGTAATGTTGAATGGCTTTGGCACAGTAGTTAATGCTCTTGGCAAACGAGTCAAACCATACTTGCCTCAGATCTGTGGTACAGTTTTATGGCGTTTA

AATAACAAATCAGCAAAAGTTAGGCAACAAGCAGCTGACTTGATTTCTCGAACTGCTGTTGTTATGAAGACTTGTCAAGAG GAAAAACTGATGGGGCAC

TTGGGTGTGGTGCTGTATGAATATTTGGGTGAAGAGTACCCTGAAGTATTGGGCAGCATTCTTGGAGCACTGAAGGCTATTGTAAACGTAATAG GTATG

CATAAGATGACACCACCAATTAAAGATCTCCTGCCTAGACTCACCCCCATTTTAAAGAACAGACATGAAAAAGTACAAGAGAATTGTATTGATCTTGTTG

GACGCATTGCTGACAG GGGAGCTGAATATGTATCTGCAAGAGAATGGATGAGGATTTGCTTTGAGCTTTTAGAGCTCTTAAAAGCTCACAAAAAAGCTA

TTCGAAGAGCTACCGTCAATACATTTGGTTATATCGCAAAGGCTATTGG CCCTCATGATGTATTGGCTACACTTTTAAACAACCTCAAAGTTCAGGAAA

GGCAGAACAGGGTTTGTACGACTGTAGCCATAGCCATTGTTGCTGAAACATGCTCCCCCTTCACAGTACTGCCTGCCTTAATGAATGAATACAGAGTTCC

TGAACTTAATGTGCAAAATGGAGTGTTAAAATCACTCTCCTTCTTGTTTGAGTATATCGGCGAAATGGGGAAAGACTACATCTATGCTGTGACGCCTTTA

CTTGAGGATGCGTTAATGGACAG - UNI27279 - GGACCTTGTTCACAGACAGACAGCGAGTGCAGTGGTGCAGCACATGTCACTTGGTGTTTACGG

ATTTGGCTGTGAGGATTCTCTGAATCACTTACTGAACTATGTGTGGCCTAATGTGTTTGAGACATCTCCCCATGTAATCCAGGCAGTTATGGGAGCTCTG

GAGGGCCTGAGGGTTGCTATTGGACCATGCAGAATGTTGCAGTATTGCTTACAG GGTCTGTTCCACCCAGCTCGGAAAGTCAGAGACGTATATTGGAAA

ATTTACAACTCCATCTACATTGGCTCCCAGGATGCTCTCATAGCACATTACCCACGAATCTACAATGACGATAAGAACACCTATATTCGTTACGAACTTG

ACTATATCTTGTAACTTTGTGTCTAATACAGCTGTTTCACACCTTAAACCTGCTTCAATCTGATGATATAAACTTGTAAAACATTGCCGATCAGTGTAGA

GCTGGTCATAGTGGAGGGATAGAAATCCAGTAGCATGATTTTTAAATAACTTTTGTTTTTTTGATGTTAAACAGTAAATGGCAGTAGTGACCAAGGACAG

TGCTTATACACACTATACTGGAGGGATATCATTTTTTATTCATCTTTATGAAGATTTAGAATTCATTCCTTGTGTTTAAAGGGAATGTTTAATTGAGAAA

TAAACATTCGTGTACAAAATGCTAATTTGTGTGTGTTTTTTGAATATGACTTGTAAAATGCAAAACTTTGGTAAAGTACTGGTTTGTGTAGAATAAGTGG

ATTAATTTCATCTTTTGTCACCTAGTTTATTATGGAACACAGCAGCACGCAAACTATATAGTGATGGCCTGTTTGTCAAAAGCCCATTGTTTTGTTGGTA

ATGAAGAGTAGCTTGGGGTGCCCCTCCCCTCAGTGTAGCATAACAGTTCCAGCACCATAGAAAAGTAGCACTCTGACTGAGCTGTCTTAAGTATTATTTT

GTACTTACATAGCACCTTTCACCTTGATTTCTCAAAATGCTTTATGAGCAGACATGAAGGATATATTTTACTTCTTGTCCAACTTTGGCCTGTGCTTATA

AAGTGGAGAAGCTGTCTGTAACTTAGAATAGTGTATTTCCTGTTGGGAGTGAGGCTATCTAAGAAATAATTATATAGTAGGACAGTCTTTGGGCTTTTGT

GTGATGCCTCTAATCAGTTTATTTATAAGCAGCTATTGAACACCTGTTGAATGCTAGCCACTGTCTGTTGAAGAAGGGGCTTCGAAGGTGCACATGATCC

GGCCTTTCATGTAACGGAAGGGTGGGCGCAGATCCTTAGGTACCAGGGTGCTGTGCAATGGAAGATGCAGAGATGCCTAGATTTGCTTAGCTTGTATGTA

GCAGTCAGATACTGTATTGGCTTAAGTGTGAGCATAAGCCAAAATGCCGTTCAGTTTATGAAGAACAAGCATTAAGGGGCTATTTTAATGTTTTGGGTCA

ACTAATGAATCAGCTTTTTTTTGTTGTTGTTTATTGTTTTTTAATTTTATGCCCCAAATTTCTTGTTTTTAAAACTTTTCTAGCCATCACTGTTTTGTCT

CCCTCTGTACTTGTGTGGACTCTAAAAGGAAATAAATTCTGCCATCAGTGTGACTGGCATGTGACTCTACCACCCTCAGACTGTCAGGAGTGCTAGGCAG

CTTGTGCTTCTGACTGTTAACAAGGAAGACTCTGGTGGAAGATCAGATTAGATTAGAGACAGCTTCTGCTCTGCTTTCTCAGAATGGATACTGAGCATTA

ACCGTCCCCATGCAGGACGCACGGATTCTTGTTCTTTGTATGTGGTCTGACTATCATTGTGTAGTAAACCATTTCCCTGTTCTTAGAAAATTCCTAGCCA

TACCTAAGCACTTTTAAATGTTTTGTATAGTTGATTTCAAATAACCCTTGGTAATTACAATCTTGAATTGAGTATATTTCTCAAAGTTAAAATTTGACTT

TAAACCACTTGGGAACATTTTATTGTATTATTAATTAAAATACTTAAGTTTGTTTAACTTCTTGCTTTTTATTTAAAAATTAAATTTTGCAGTAGAACTA

CAGCTCACAGGAGACTGCTTACCCCTTAAGTGACATTTTCCTGATGGAGGTAATCTGAGAATGGATAAGGGGAAAAAATGCTGAAGGCTGCAATCTCAAG

ATTAGGACCAAAATAGATACTCAAAGATGTTTGGATTGTGAAATGCTCTTATTGAATAAGGAAAGCATTTTGGGATAAACCCTTGTGAAAGATGCTATGT

CACGTTTTAACACTTCTCAACTAAGACCTTTTCTTTAGCACTTTGATGTTTCTTAAGGTGAAACTTAGGCAGGAGGAATTCATGTTCTTAAGGGGACAGA

GGGGTGGGTTTTTCTCTGGGCTTTGGTTTTTTTTTTCTCTGGGCATTGCCCTCTGATGGAATTGATATTTCTTTGGCTGTTTGATTTTATTTTTTTTTAT

ATTGTATTTTTAATATTTGTTGTATGGTGCCCTGTGAGCATCAAGTACCACCAGATAAATAAAACTTATCACATCT
Translation
MAKIAKTHED - UNI5576 - DIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELED DDDDYSSSTSLLGQKKPGYH

APVALLNDIPQSTEQ - UNI25671 - YDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADG GGKTPDPKMNARTYMDVMREQHLTKEE REI

RQQLAEKAKAGELKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAE TPGHTPSLRWDETPGRAKGSETPGATPGSKIWDPTPSHTPAGAAT

PGRGDTPGHATPGHGGATSSARKNRWDETPKTERD DTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPIGTPAM

NMATPTPG GHIMSMTPEQLQAWRWEREIDERNRPLSDEELDAMFPEGYK - UNI6694 - VLPPPAGYVPIRTPARKLTATPTPLGGMTGFHMQTED

RTMKSVNDQPSGNLPFLKPDDIQYFDKLL VDVDESTLSPEEQKERKIMKLLLKIKNGTPPMRK AALRQITDKAREFGAGPLFNQILPLLMSPTLEDQE

RHLLVKVIDRILYKLDDLVRPYVHK ILVVIEPLLIDEDYYARVEGREIISNLAK AAGLATMISTMRPDIDNMDEYVRNTTARAFAVVASALGIPSLLP

FLKAVCKSKKSWQARHTGIKIVQQIAILMGCAILPHLRSLVEIIEHG GLVDEQQKVRTISALAIAALAEAATPYGIESFDSVLKPLWKGIRQHRGK GL

AAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSPDEEMKKIVLK VVKQCCGTDGVEANYIKTEILPPFFKHFWQHRMALDRRNYRQ - UNI4908

 - LVDTTVELANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLGAADIDHKLEEQLIDGILYAFQEQTTE DSVMLNGFGTVVNALGKRVKPY

LPQICGTVLWRLNNKSAKVRQQAADLISRTAVVMKTCQE EKLMGHLGVVLYEYLGEEYPEVLGSILGALKAIVNVIG GMHKMTPPIKDLLPRLTPILK

NRHEKVQENCIDLVGRIADR RGAEYVSAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIG GPHDVLATLLNNLKVQERQNRVCTTVAIAIVAE

TCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDR - UNI27279 - RDLVHRQTASAVVQHMSLGVYGFGCED

SLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQ GLFHPARKVRDVYWKIYNSIYIGSQDALIAHYPRIYNDDKNTYIRYELDYIL

For any suggestions or comments, please send an email to unitrap@crg.es