Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026094 (Stk17b)
Chromosomal location
Chr 1: 53812358 - 53841998 (-)
Description
serine/threonine kinase 17b (apoptosis-inducing) Gene [Source:MGI (curated);Acc:Stk17b-001]
RefSeq_dna
NM_133810 
RefSeq_peptide
NP_598571.2 
UniGene
Mm.25559 Mm.392998 
MGI
MGI:2138162 
Uniprot/SWISSPROT
Q8BG48 
Human Ortholog
ENSG00000081320 (STK17B)
Omim not available
UniTrap UNI28179
Vector Insertion
Chr 1: 53833524 - 53841917
Public Clones not available
Private Clones OST37958 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32202
Vector Insertion
Chr 1: 53812357 - 53818006
Public Clones IST11256G10 (tigm) IST12943F9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027263
Sequence
AGCGTCTGTGCGGTCGCCGCCGGGAGTCGCCTCACAGGGGCCTGGCTGACGGCGACCAGCCGTTGTGGGGAAGAGTGCGAG - UNI28179 - GTAAA

AGTCTGCCTAGAGAAGCAGGTCTGGCAGTCATCAACATGTCTCGGAGGAGATTCGATTGCCGAAGTGTCTCAGGCTTGCTAACTACAACCCCTCAAACGC

CGATTAAAACAGAGAATTTTAATAATTTCTATACTCTTACCCCAAAAGAACTTGGGAG AGGAAAATTTGCTGTGGTTAGACAATGTATATCAAAATCAA

CTGGACAAGAGTATGCTGCCAAATCCCTGAAAAAGAGGAGAAGAGGGCAGGATTGCCGGGCGGAAATTCTGCATGAGATAGCTGTGCTGGAGCTGGCCAG

GTCTTGTCCCCACGTGATTAATCTGCATGAGGTCTACGAAAATGCAACGGAAATCATTTTGGTGTTAGAATA TGCTGCGGGTGGAGAAATTTTCAACCT

GTGTTTACCTGAGTTAGCCGAAATGGTATCTGAAAATGATGTTATCAGACTCATTAAACAAATCCTTGAAGGAGTTCATTATCTACATCAGAATAACATT

GTTCACCTTGATTTAAAG CCACAGAATATACTTTTGAGCAGTATATACCCACTCGGGGACATAAAAATTGTAGATTTTGGAATGTCTCGAAAAATTGGG

AATGCAAGTGAGCTTCGGGAAATCATGGGAACACCTGAATACTTAG CTCCAGAAATCCTCAACTATGATCCCATTACCACAGCAACAGATATGTG - U

NI32202 - GAATATTGGCATAATAGCGTATATGTTGTTAACTCATACATCACCATTTGTAGGAGAAGATAATCAAGAAACATATCTGAATATTTCTCA

AGTGAATGTAGATTATTCAGAAGAAATGTTTTCATCAGTTTCACAGCTGGCCACAGACTTCATCCAGAGCCTTCTAGTAAAGAACCCAGA - UNI3220

2 - GAAAAGACCAACAGCAGAATCCTGCCTATCCCACTCATGGCTGCAGCAGTGGGACTTTGGAAGCTTGTTTCATCCTGAGGAAACTTCAGGCTCCTC

TCAAATTCAGGATCTGACTCTCAGGTCCTCTGAAGAGAAGACCTCCAAGTCCTCCTGTAATGGGAGCTGTGGAGCCCGGGAGGACAAGGAGAACATCCCT

GAAGATGGCAGCTTAGTTTCTAAAAGATTTCGATTCGATGACTCCTTGCCCAGCCCCCATGAACTTGTTCCAGATTTGTTCTGTTAGCATTTTTCTCTGT

GACTCATCTGGACTGACTCGGAAATTTGAAATCTCTGGTGTGAGATTGTGTTTGTAGCTTCATATATTATGTTTATATTATAAATGCACTTCTGCTTAGA

AGAACTTAAGGAACAGTTTAAATGCTAGGCTTCTGTTGGCTAGCATATCATTTCTTGTCCTGAAATTGTTTTGCAGAGGAAAATATTTAAGTATATGACA

AAAAATGTAAATTGTGTTTAAGAGAACACATGCAACTGAAAGAACTCAAGTTCAGTCAGACTTATAAAATGGGTTATATTATGGTTAGTAAAAGTTGAAA

AAAAATGAAAACAGGAATTTAGTAGGTTCTAAGGTAAGCCCTATACCATAACTCTATTACAGAGAATCTGTTTGGGGAAATGCTGTCAAGGGTAAACCAC

AACATATACTGCTTTATAAATACTCCAGAGAGAGTTTATAGTTGAAAGTATTTCCCAGTTACCAATAATAGCTTGAAACTGTAAGATTTTCTTTGTGTGC

CATGTGCTCGGTGAGAGGACACAGTCAACCAGAGCAGGGTTGATCCAGGCTGTTTCTCTGCAAACCGAGTCAAAACTCGACATCATTTCCAGCTCATGTA

TTTTGTACGTGCATCATATATCAGATCTAATAAGATCTGGAAGATGGATATGCAAATAAGAGGCCTTTGTCTTCTAGAATGATTAGAGTAGAGGAGAATT

GGATAGTACAGAATATGCTCTAGTTTCAGTCAGACATATTCATAAAGGGAAATGTTAAGTTCTGGCAGCTGACTTAGTGTTGGATGTCTCCTAAGTCTCA

GGATAGAAGCCCATCATTAGAGCATAGGCACTTCAGGAATTCTTGTGTGAAATTCTAGTGAGTGAGGAGGTGTGACATGCAGCTATCTTTGGGCTCCTTT

TGTGTGTGTTCTGCTGGACACAACACATGGGAGTGTTCAGTGTTGTCCGTGGTCAATATCTATGTTCAGTCCTGATGGGAGGGGCCTAGGGACTGCTTTG

GAGATTTCCCACTGGTGTCCATTTTAAGGTCTGTAATAATGTCATGTTAAGATAACAGATCTCATAAATATGCTACTCTATCAGACTCCGTTGCCAAAAC

AAATTAAAAGCCTGTGTATTGAAGTGGGTGTTAGTCTAACAACCTGTAAATTCTTGAAATTGTTACTAAAATTCCAAATTCTTTAGATAACTTTAAACTA

TTTAAATTGAGCATTGCTGTCTTTGTTTGATTAAAGGTTGAGTTCCTTTATATCTGTTATTTTTAAAGGAAAAGTTGTTTGCCTTTTGTATATGTGTGTG

CATATGTGTATGTGTACAGGTATATGTATATATGTATTGATAGATAAAATACAGCCTTTAAACAACTTCATGTTAGATATTCTTTCCTTGTGTATTATGT

TCAACTCAGGTGCCAAAAGAGCCCTCTTATCTGAATAATAAGTATGCCCATACATTCTTTAAGAAGTAGTCTGTTGGTCCAAGAAGCCAAACACTAAAGA

TGCTAAATTTAACTCTTGTGTTTCTGAAATTGAGAAGCTGTTGGTAAATTATTACTTGTATACTTTCCATCAGTGTTAATTCAGGTAATGTCATTAGTCT

GTCATTAGGAAATGTGGTTACTTTCCCAAACAGTGATATTTTATTGTAAAACTTTAAAAAGTATTATGCCACTCACCAAAAGTAAGCATTTGAAAATTTA

ATTTTAAGTCATTTGTTTAAAACCACTTTTTATTGTCTATATATATACATTTTTTCCCCCTGAGGAATCCTGAGATAGTTTGTGTGTTCCCCTTCGTTAA

TTGGCTACCAGGTTGTAAACTCCCATACCTTTCCTTGGGACATTGCTTATTGTAAAAGAGTAGCTAGTGGTTGCACACAATAAAAAAGCAGTCTTTCCAT

AAAAGCAAATTTACAAATTTCCCATGTTGAAGTGTGGCAATAAATGTCTTCTGAGAGAGTT
Translation
 - UNI28179 - MSRRRFDCRSVSGLLTTTPQTPIKTENFNNFYTLTPKELGR RGKFAVVRQCISKSTGQEYAAKSLKKRRRGQDCRAEILHEIAVL

ELARSCPHVINLHEVYENATEIILVLEY YAAGGEIFNLCLPELAEMVSENDVIRLIKQILEGVHYLHQNNIVHLDLK PQNILLSSIYPLGDIKIVDFG

MSRKIGNASELREIMGTPEYLA APEILNYDPITTATDMW - UNI32202 - WNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEEMFSSVSQ

LATDFIQSLLVKNPE - UNI32202 - EKRPTAESCLSHSWLQQWDFGSLFHPEETSGSSQIQDLTLRSSEEKTSKSSCNGSCGAREDKENIPEDGSL

VSKRFRFDDSLPSPHELVPDLFC

For any suggestions or comments, please send an email to unitrap@crg.es