Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026111 (Unc50)
Chromosomal location
Chr 1: 37487015 - 37495969 (+)
Description
unc-50 homolog (C. elegans) Gene [Source:MGI (curated);Acc:Unc50-001]
RefSeq_dna
NM_026123 
RefSeq_peptide
NP_080399.1 
UniGene
Mm.27404 
MGI
MGI:1914637 
Uniprot/SWISSPROT
Q9CQ61 
Human Ortholog
ENSG00000115446 (UNC50)
Omim not available
UniTrap UNI23393
Vector Insertion
Chr 1: 37487339 - 37488137
Public Clones (sanger)
Private Clones OST261206 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000118059
Sequence
GCCCCAGCGGCGGCTGGGCTCGGCTGCCCTGGGAAGGTGGCGGTAGTCCCGGGCCCAGGACGAGGCCTCGAGGGCCTTCAGGTGCGGCCTGCTCTGTGTG

CGCAGGGTGGCGTTCGTGCCGTCGGCCGTTTCCACGGTTAGCTCGCGACCTGGCGTCTCAGCGGCTGGGCGAGGGACCGGCCGGCGCCCGGCAGCTCGAG

TCCTAGGCCCGCCGTGGAGCTGCTGG - UNI23393 - GAAGATGCTACCAAGTACTTCCTTGAGTTCTTCGATGCACGGGAATGGAGTATTAAATTC

CAGGGATGCAGCAAGGCACACGGCTGGAGCAAAACGCTACAAGTACCTCAGAAGGCTCTTTCGATTTCGGCAGATGGACTTTGAGTTTGCTGCATGGCAG

ATGCTCTACCTGTTTACCTCTCCTCAGAGGGTTTATAGAAACTTTCACTACCGGAAGCAAACAAAGGACCAGTGGGCCAGAGATGACCCTGCCTTCTTAG

TCCTCTTAAGTATCTGGCTCTGTG TGTCCACCATAGGATTCGGCTTTGTGCTGGACATGGGATTTTTTGAGACAATAAAGCTGCTGCTGTGGGTTGTGT

TTATAGATTGTGTGGGTGTTGGCCTTCTGATCTCAACGTTAATGTG GTTCGTCTCCAACAAGTACCTGGTGAAACGCCAGAGCAGGGACTATGACGTGG

AGTGGGGCTATGCCTTTGATGTGCATCTGAACGCCTTCTATCCGCTCCTCGTCATTCTGCATTTTATCCAGCTCTTCTTCATCAACC ATGTTATTCTCA

CAGATACATTTATTGGATATTTAGTTGGAAATACCTTATGGTTGATTGCTGTTGGCTATTATATCTATGTGACCTTCCTGGGATACAGTG CACTGCCAT

TTTTGAAAAATACAGTGATCCTGCTCTATCCATTCGCACCTCTCATGGTGCTGTACGGGCTGTCGCTGGCACTGGGATGGAACTTTACCCACACATTGTG

TTCCTTCTACAAGTACAGAGTGAAGTGAGCATCCTAGAGAAACTGTCTGGTGTTGGGAAGGGATGAGTTCTTGTAAATCTGTAAATAGCTTCAATAAGAT

GTAAAGTTTTACAAATTCAAGGTGATATTAACACTTGTGTAGAACATTCCTTAAAACTAATTAAATGTACATTTCTAATAAATATTTTTAAACTAAA
Translation
 - UNI23393 - MLPSTSLSSSMHGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLV

LLSIWLCV VSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLISTLMW WFVSNKYLVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFINH 

HVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSA ALPFLKNTVILLYPFAPLMVLYGLSLALGWNFTHTLCSFYKYRVK
Transcript ENSMUST00000027285
Sequence
CAAGTGCGGGCTACGTAGCGGGAAGGGAAGTGGCCCCAGCGGCGGCTGGGCTCGGCTGCCCTGGGAAGGTGGCGGTAGTCCCGGGCCCAGGACGAGGCCT

CGAGGGCCTTCAGGTGCGGCCTGCTCTGTGTGCGCAGGGTGGCGTTCGTGCCGTCGGCCGTTTCCACGGTTAGCTCGCGACCTGGCGTCTCAGCGGCTGG

GCGAGGGACCGGCCGGCGCCCGGCAGCTCGAGTCCTAGGCCCGCCGTGGAGCTGCTGGGTAAAACCAAAGACAGCCGCTTACGTGGGAATCGCAGGATTA

GAGCCGTTTTTCTATTCTAAGCAG - UNI23393 - GAAGATGCTACCAAGTACTTCCTTGAGTTCTTCGATGCACGGGAATGGAGTATTAAATTCCA

GGGATGCAGCAAGGCACACGGCTGGAGCAAAACGCTACAAGTACCTCAGAAGGCTCTTTCGATTTCGGCAGATGGACTTTGAGTTTGCTGCATGGCAGAT

GCTCTACCTGTTTACCTCTCCTCAGAGGGTTTATAGAAACTTTCACTACCGGAAGCAAACAAAGGACCAGTGGGCCAGAGATGACCCTGCCTTCTTAGTC

CTCTTAAGTATCTGGCTCTGTG TGTCCACCATAGGATTCGGCTTTGTGCTGGACATGGGATTTTTTGAGACAATAAAGCTGCTGCTGTGGGTTGTGTTT

ATAGATTGTGTGGGTGTTGGCCTTCTGATCTCAACGTTAATGTG GTTCGTCTCCAACAAGTACCTGGTGAAACGCCAGAGCAGGGACTATGACGTGGAG

TGGGGCTATGCCTTTGATGTGCATCTGAACGCCTTCTATCCGCTCCTCGTCATTCTGCATTTTATCCAGCTCTTCTTCATCAACC ATGTTATTCTCACA

GATACATTTATTGGATATTTAGTTGGAAATACCTTATGGTTGATTGCTGTTGGCTATTATATCTATGTGACCTTCCTGGGATACAGTG CACTGCCATTT

TTGAAAAATACAGTGATCCTGCTCTATCCATTCGCACCTCTCATGGTGCTGTACGGGCTGTCGCTGGCACTGGGATGGAACTTTACCCACACATTGTGTT

CCTTCTACAAGTACAGAGTGAAGTGAGCATCCTAGAGAAACTGTCTGGTGTTGGGAAGGGATGAGTTCTTGTAAATCTGTAAATAGCTTCAATAAGATGT

AAAGTTTTACAAATTCAAGGTGATATTAACACTTGTGTAGAACATTCCTTAAAACTAATTAAATGTACATTTCTAATAAATATTTTTAAACTAAAGCTGT

GACTGTTTATTTTCACTTGAAGCTGTATATAAAATATCAAGGGTACAGTAAGTGTTGGATCACACAGACCATCTTGTTGGCAAAATGAACAGTCTGTCCC

ATTTTTAAAGCCCATTTACGCAGACCCCTCCG
Translation
 - UNI23393 - MLPSTSLSSSMHGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLV

LLSIWLCV VSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLISTLMW WFVSNKYLVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFINH 

HVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSA ALPFLKNTVILLYPFAPLMVLYGLSLALGWNFTHTLCSFYKYRVK
Transcript ENSMUST00000114925
Sequence
AAGTGGCCCCAGCGGCGGCTGGGCTCGGCTGCCCTGGGAAGGTGGCGGTAGTCCCGGGCCCAGGACGAGGCCTCGAGGGCCTTCAG - UNI23393 - 

GAAGATGCTACCAAGTACTTCCTTGAGTTCTTCGATGCACGGGAATGGAGTATTAAATTCCAGGGATGCAGCAAGGCACACGGCTGGAGCAAAACGCTAC

AAGTACCTCAGAAGGCTCTTTCGATTTCGGCAGATGGACTTTGAGTTTGCTGCATGGCAGATGCTCTACCTGTTTACCTCTCCTCAGAGGGTTTATAGAA

ACTTTCACTACCGGAAGCAAACAAAGGACCAGTGGGCCAGAGATGACCCTGCCTTCTTAGTCCTCTTAAGTATCTGGCTCTGTG TGTCCACCATAGGAT

TCGGCTTTGTGCTGGACATGGGATTTTTTGAGACAATAAAGCTGCTGCTGTGGGTTGTGTTTATAGATTGTGTGGGTGTTGGCCTTCTGATCTCAACGTT

AATGTG GTTCGTCTCCAACAAGTACCTGGTGAAACGCCAGAGCAGGGACTATGACGTGGAGTGGGGCTATGCCTTTGATGTGCATCTGAACGCCTTCTA

TCCGCTCCTCGTCATTCTGCATTTTATCCAGCTCTTCTTCATCAACC ATGTTATTCTCACAGATACATTTATTGGATATTTAGTTGGAAATACCTTATG

GTTGATTGCTGTTGGCTATTATATCTATGTGACCTTCCTGGGATACAGTG CACTGCCATTTTTGAAAAATACAGTGATCCTGCTCTATCCATTCGCACC

TCTCATGGTGCTGTACGGGCTGTCGCTGGCACTGGGATGGAACTTTACCCACACATTGTGTTCCTTCTACAAGTACAGAGTGAAGTGAGCATCCTAGAGA

AACTGTCTGGTGTTGGGAAGGGATGAGTTCTTGTAAATCTGTAAATAGCTTCAATAAGATGTAAAGTTTTACAAATTCAAGGTGATATTAACACTTGTGT

AGAACATTCCTTAAAACTAATTAAATGTACATTTCTAATAAATATTTTTAAACT
Translation
 - UNI23393 - MLPSTSLSSSMHGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLV

LLSIWLCV VSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLISTLMW WFVSNKYLVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFINH 

HVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSA ALPFLKNTVILLYPFAPLMVLYGLSLALGWNFTHTLCSFYKYRVK

For any suggestions or comments, please send an email to unitrap@crg.es