Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026193 (Fn1)
Chromosomal location
Chr 1: 71632094 - 71699746 (-)
Description
fibronectin 1 Gene [Source:MGI Symbol;Acc:MGI:95566]
RefSeq_dna
NM_010233 
RefSeq_peptide
NP_034363.1 
UniGene
Mm.398935 Mm.193099 
MGI
MGI:95566 
Uniprot/SWISSPROT
P11276 
Uniprot/SPTREMBL
Q3TBB4 Q3TCF1 Q3TCL7 Q4KL80 Q99KD0 Q9Z1Z7 Q3UHL6 Q8R3F3 Q9Z1Z8 Q3UZF9 
Human Ortholog
ENSG00000115414 (FN1)
Omim 601894 - GLOMERULOPATHY WITH FIBRONECTIN DEPOSITS 2  
UniTrap UNI29586
Vector Insertion
Chr 1: 71698094 - 71699747
Public Clones E324C10 (ggtc) CMHD-GT_465B7-3 (cmhd) IST10157F11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10547
Vector Insertion
Chr 1: 71697274 - 71698094
Public Clones G074C02 (ggtc) G045E07 (ggtc) G039H09 (ggtc) IST11066F11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10563
Vector Insertion
Chr 1: 71695900 - 71697135
Public Clones (sanger) G026G10 (ggtc) G029H09 (ggtc) G079G09 (ggtc) G030H08 (ggtc)
G082D11 (ggtc) IST11555F7BBF1 (tigm) IST14746B9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11231
Vector Insertion
Chr 1: 71694721 - 71695767
Public Clones (sanger) E324F11 (ggtc) G032D01 (ggtc) IST12687C1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8476
Vector Insertion
Chr 1: 71692277 - 71694582
Public Clones (sanger) RST688 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9139
Vector Insertion
Chr 1: 71689726 - 71692120
Public Clones RST455 (baygenomics) E323G12 (ggtc) G074A10 (ggtc) IST12348D9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11300
Vector Insertion
Chr 1: 71678737 - 71683825
Public Clones G069A06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10292
Vector Insertion
Chr 1: 71667394 - 71670651
Public Clones PST086 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10657
Vector Insertion
Chr 1: 71660610 - 71661933
Public Clones G021C03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10319
Vector Insertion
Chr 1: 71657593 - 71659041
Public Clones Ex260 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27938
Vector Insertion
Chr 1: 71654595 - 71655986
Public Clones (sanger)
Private Clones OST43602 (lexicon)
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9136
Vector Insertion
Chr 1: 71649072 - 71650233
Public Clones RST388 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10378
Vector Insertion
Chr 1: 71637467 - 71639644
Public Clones Ex180 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11217
Vector Insertion
Chr 1: 71636779 - 71637340
Public Clones G084G07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6951
Vector Insertion
Chr 1: 71633518 - 71636671
Public Clones LST053 (baygenomics) P073D09 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000087254
Sequence
GCTCGCACCCGCTGCGCTGCACAGGGGGAGAAAAGGAGCCCAGGGTGTGAGCCGGACAACTTCTGGTCCTCTCCTTCCATCTCCTTACCGGCGTCCCCAC

CTCAGGACTTTTCCCGCAGGCTGCGAGGGGACCCACAGTTCGTGGCCACTTGCCTCCTGGGGAGGGCGACTCTCCTCCCATCCACTCAAGATGCTCAGGG

GTCCGGGACCCGGGCGGCTGCTGCTGCTGGCAGTCCTGTGCCTGGGGACCTCGGTGCGCTGCACCGAAGCCGGGAAGAGCAAGAGGCAGGCTCAGCAAAT

CGTGCAGCCTCAATCCCCGGTGGCTGTCAGTCAGAGCAAGC - UNI29586 - CTGGCTGTTTTGACAATGGGAAGCACTATCAGATAAATCAGCAGT

GGGAACGGACCTACCTAGGCAACGCCCTGGTTTGTACCTGCTATGGAGGAAGCCGGGGTTTTAACTGCGAGAGCAAGCCTGAGC - UNI10547 - - 

UNI29586 - CTGAAGAGACTTGCTTTGACAAATACACTGGGAACACTTACAAAGTGGGTGACACTTATGAGCGCCCTAAAGATTCCATGATCTGGGAC

TGTACCTGCATCGGGGCTGGGAGAGGCAGGATCAGCTGTACCATTGCAA - UNI10563 - ATCGCTGCCATGAAGGGGGTCAGTCCTACAAGATTGG

CGACAAGTGGAGGAGGCCACATGAGACTGGTGGCTACATGTTAGAGTGTCTGTGTCTGGGAAATGGAAAAGGGGAATGGACCTGCAAACCTATAG - UN

I11231 - CTGAGAAGTGTTTTGATCATGCTGCTGGGACGTCCTACGTCGTGGGGGAGACCTGGGAAAAGCCCTACCAAGGCTGGATGATGGTGGACTG

TACTTGTCTAGGCGAAGGCAATGGACGCATCACCTGTACCTCCAGAA - UNI8476 - ACAGATGCAACGATCAGGACACCCGGACATCCTATAGGAT

TGGAGACACGTGGAGCAAGAAGGACAACCGAGGAAACCTGCTTCAGTGTGTCTGCACAGGCAATGGCAGAGGGGAGTGGAAGTGTGAGCGACATGCTCTA

CAAAGTGCTTCAGCCG - UNI9139 - GATCTGGCTCCTTCACTGATGTCCGAACAGCTATTTACCAACCGCAGACTCACCCCCAGCCCGCTCCCTAC

GGCCACTGTGTCACCGACAGTGGTGTGGTCTACTCTGTGGGAATGCAGTGGCTGAAGTCGCAAGGAAACAAGCAAATGCTGTGCACGTGCCTGGGCAATG

GCGTCAGCTGCCAGGAGACAG CCGTGACCCAGACTTATGGTGGCAATTCAAACGGGGAGCCCTGTGTCCTCCCGTTCACCTACAACGGTAGGACCTTCT

ATTCCTGCACCACCGAAGGGCGGCAAGACGGACATCTGTGGTGTAGCACAACTTCCAATTACGAACAAGACCAGAAGTATTCCTTCTGCACAGACCATGC

GG TTTTGGTTCAGACTCGAGGCGGAAATTCCAATGGTGCTCTGTGCCACTTCCCCTTCCTGTACAACAACCGGAATTACACCGACTGTACTTCTGAGGG

TCGCAGGGACAACATGAAATGGTGCGGCACCACCCAGAACTACGATGCCGATCAGAAGTTTGGATTCTGCCCAATGGCTG CCCACGAGGAGATCTGCAC

AACCAATGAAGGGGTCATGTATCGCATTGGGGATCAGTGGGATAAGCAGCATGACCTGGGCCACATGATGAGGTGCACGTGTGTGGGGAACGGTCGTGGA

GAATGGGCCTGCATCCCCTACTCCCAGCTCCGAG ACCAGTGCATCGTTGATGACATTACTTACAATGTGAACGACACGTTCCACAAGCGTCACGAGGAG

GGACATATGCTGAACTGTACCTGCTTTGGTCAGGGCCGGGGCAGATGGAAGTGTGACCCCATTG ACCAGTGCCAAGATTCAGAGACCCGGACATTTTAC

CAGATTGGTGACTCCTGGGAGAAGTTTGTGCATGGTGTCCGATACCAGTGTTACTGCTACGGCCGTGGCATCGGGGAGTGGCACTGTCAACCTCTGCAGA

CCTACCCAG - UNI11300 - GCACAACTGGACCTGTCCAAGTAATTATCACGGAGACCCCCAGCCAGCCCAATTCCCACCCCATCCAGTGGAATGCC

CCGGAGCCTTCACACATCACCAAGTACATTCTCAGATGGAGACCT AAAACCTCTACGGGTCGCTGGAAGGAAGCTACCATTCCTGGCCACCTTAACTCC

TATACCATCAAAGGCCTGACCCCAGGTGTGATCTATGAGGGACAGCTCATCAGCATCCAGCAGTATGGCCACAGAGAAGTGACACGCTTCGACTTCACCA

CCAGCGCCAGCACCCCTGTGACCA GCAACACGGTGACCGGAGAGACTGCGCCCTACTCTCCTGTTGTGGCCACTTCTGAATCTGTAACTGAAATCACAG

CCAGCAGCTTTGTGGTCTCATGGGTCTCAGCCTCCGACACCGTGTCAGGCTTCCGGGTGGAGTATGAGCTGAGCGAGGAGGGAGATGAACCACAGTACCT

TG ATCTCCCAAGCACGGCCACTTCCGTGAACATTCCTGACCTGCTCCCGGGCAGAAAGTACATTGTCAATGTCTATCAGATATCTGAGGAGGGAAAACA

GAGCTTGATCCTGTCTACCTCACAGACTACAG CACCTGACGCTCCTCCAGACCCTACCGTGGACCAGGTTGATGATACTTCCATTGTTGTTCGGTGGAG

TAGACCCCAGGCACCTATCACAG GGTATAGAATTGTCTATTCACCTTCAGTAGAAGGCAGTAGCACAGAGCTCAACCTCCCTGAAACGGCCAACTCCGT

CACCCTCAGCGACCTGCAGCCCGGTGTTCAGTACAACATCACTATCTATGCTGTGGAGGAGAACCAGGAGAGCACACCCGTTTTCATCCAACAAGAGACC

ACTGGCACCCCAAGATCTG ATAACGTCCCCCCTCCGACGGACCTACAGTTTGTGGAACTGACTGATGTGAAAGTCACCATCATGTGGACCCCTCCTGAT

AGTGTGGTGTCTGGATACCGTGTGGAGGTCCTGCCTGTCAGCCTGCCCGGGGAACATGGGCAGAGGCTGCCTGTCAACAGAAATACCTTTGCTGAAATCA

CTGGGCTGTCCCCTGGGGTCACGTACCTCTTCAAAGTCTTTGCTGTGCACCAGGGCAGGGAAAGCAATCCTCTGACGGCACAACAGACCACCA AACTCG

ACGCTCCCACTAACCTCCAGTTTGTCAATGAAACTGACAGAACAGTTCTGGTAACGTGGACTCCACCTCGAGCCCGTATAGCAGGCTACCGACTGACCGC

GGGCCTGACCCGAGGAGGCCAGCCCAAGCAGTACAATGTGGGACCCTTGGCCTCCAAGTATCCCCTGAGAAATCTGCAGCCTGGGTCTGAGTACACCGTG

ACCTTGGTGGCTGTGAAAGGGAACCAGCAGAGTCCCAAAGCCACCGGAGTCTTTACTACCC - UNI10292 - TGCAGCCTCTGCGCTCCATTCCACC

TTACAACACCGAGGTGACAGAGACCACAATTGTGATCACCTGGACCCCCGCTCCAAGGATTGGCTTCAAG CTGGGTGTACGACCGAGCCAGGGAGGTGA

GGCACCCCGAGAAGTGACTTCAGACTCTGGGAGCATTGTTGTGTCTGGCTTGACTCCAGGCGTGGAATACACTTACACCATCCAAGTCCTGCGAGATGGC

CAGGAGAGAGATGCACCGATTGTCAACAGAGTAGTGACAC CGCTGTCTCCACCGACCAACTTGCATCTGGAGGCAAACCCTGACACTGGAGTGCTTACT

GTCTCCTGGGAGAGGAGCACTACCCCAG ATATCACTGGCTACAGAATAACTACTACCCCCACGAACGGGCAGCAGGGGACCTCTCTGGAAGAAGTGGTC

CATGCTGATCAGAGTTCCTGCACTTTTGAGAACCTGAATCCTGGCCTGGAGTACAACGTCAGTGTTTACACTGTCAAAGATGACAAGGAAAGTGCCCCTA

TCTCTGATACCGTTGTCCCAG - UNI10657 - CTGTCCCTCCTCCCACGGATCTGCGATTCACCAATATCGGTCCAGACACGATGCGGGTCACTTGG

GCCCCGCCTCCGTCCATCGAGCTGACCAACCTCTTGGTGCGCTACTCACCCGTGAAGAATGAAGAGGACGTTGCAGAGCTATCCATTTCACCTTCAGACA

ATGCCGTGGTCCTAACAA - UNI10319 - ATCTCCTGCCTGGGACAGAATACTTAGTCAGTGTCTCCAGTGTCTACGAACAACATGAGAGCATCCCT

CTCCGGGGAAGGCAGAAAACAG GTCTCGATTCCCCAACTGGTTTTGATTCTTCTGATATCACCGCCAACTCATTCACTGTCCACTGGGTGGCTCCTCGG

GCCCCCATCACCGGCTACATCATCCGCCATCACGCCGAGCATTCTGTCGGAAGACCCAGGCAGGATCGAGTGCCGCCCTCGCGGAATTCCATCACCCTCA

CCAACCTTAATCCGGGCACCGAGTACGTTGTCAGCATCATTGCTGTTAATGGCAGAGAGGAGAGCCCGCCACTGATTGGCCAGCAAGCCACAG - UNI2

7938 - TTTCTGATATTCCGAGAGATCTGGAGGTCATTGCCTCCACCCCCACCAGCCTGCTCATCAGTTGGGAACCCCCTGCCGTCTCTGTGCGCTATT

ACAGAATCACCTACGGAGAGACAG GAGGAAATAGCCCTGTCCAGGAGTTCACTGTGCCCGGAAGCAAGTCCACAGCCACCATCAACAACATTAAACCAG

GAGCAGACTACACCATCACCCTGTATGCTGTCACTGGCCGTGGGGACAGTCCAGCAAGCAGCAAGCCAGTTTCCATCAATTATAAAACAG AAATTGACA

AGCCGTCCCAGATGCAGGTGACAGATGTCCAGGACAACAGCATCAGTGTCAGGTGGCTGCCTTCAACTTCTCCTGTGACAGGCTACAGAGTGACCACCAC

TCCCAAAAATGGCCTAGGACCATCAAAAACTAAAACTGCCAGTCCAG ATCAAACAGAAATGACCATTGAAGGTTTGCAACCCACTGTGGAGTACGTGGT

TAGTGTTTATGCTCAGAACCGGAACGGAGAAAGCCAGCCCCTGGTTCAAACTGCAGTGACCA - UNI9136 - CCATTCCTGCGCCCACCAATCTGAA

GTTCAGTCAGGTGACACCCACCAGCTTTACTGCCCAGTGGATAGCACCCAGTGTTCAGCTCACTGGCTACCGGGTGCGGGTGAACCCGAAAGAGAAGACA

GGACCAATGAAAGAAATCAACCTTTCTCCAGACAGCTCATCGGTGATTGTGTCAGGACTCATG GTGGCCACTAAATACGAAGTCAGTGTCTATGCTCTC

AAGGACACACTGACAAGCAGACCAGCCCAGGGAGTCATCACTACTCTGGAGA ATGTTAGCCCTCCAAGAAGGGCCCGTGTGACGGACGCTACAGAGACC

ACCATCACTATTAGCTGGAGAACAAAGACAGAGACAATCACTGGCTTCCAAGTCGATGCCATCCCAGCCAATGGCCAGACCCCAGTTCAGAGGAGCATCA

GCCCGGATGTTAGAAGCTACACCATTACAG GTTTACAGCCAGGCACTGACTACAAGATCCACCTGTACACTCTGAACGACAATGCCCGGAGCTCGCCCG

TGATCATCGATGCCTCCACCG CCATCGACGCACCATCCAACCTGCGGTTCCTGACCACCACACCCAACTCCTTGCTGGTGTCATGGCAGGCGCCCCGTG

CCAGGATTACTGGCTACATTATCAAGTATGAGAAGCCTGGATCCCCTCCCAGAGAAGTGGTCCCTCGGCCCCGCCCTGGTGTCACGGAGGCCACCATTAC

TG GTCTGGAGCCAGGAACCGAGTACACCATCTACGTCATTGCCCTGAAGAACAATCAGAAGAGTGAGCCCCTGATTGGGAGGAAGAAGACAG ATGAGC

TTCCCCAACTGGTTACCCTTCCACACCCCAATCTTCATGGACCAGAGATCTTGGATGTTCCCTCCACAGTTCAAAAGACCCCCTTCATCACCAACCCTGG

GTATGACACCGAAAATGGTATTCAGCTTCCTGGCACAACCCACCAGCAACCCAGTGTTGGGCAACAAATGATCTTTGAGGAACATGGCTTTAGGCGGACA

ACGCCACCCACTGCGGCCACCCCCGTCAGGCTTAGGCCAAGACCATACCTGCCGAATGTAGATGAGGAGGTCCAAATCGGTCATGTTCCCAGGGGAGACG

TAGACTACCACCTCTATCCTCATGTTCCGGGCCTCAATCCAAATGCCTCTACAGGACAGGAAGCTCTCTCTCAGACAACCATCTCTTGGACGCCGTTCCA

GGAGAGTTCTGAGTACATCATTTCATGCCAACCAGTTGGCACCGACGAAGAGCCCTTACAG TTCCAAGTTCCTGGAACTTCTACCAGTGCGACTCTGAC

TGGCCTTACCAGAGGGGTCACCTACAACATCATAGTGGAGGCACTGCAGAACCAGAGGAGGCACAAGGTTCGGGAAGAGGTTGTGACTGTGGGCAACGCT

G TCAGCGAAGGCCTGAACCAGCCTACAGATGACTCATGCTTTGACCCTTACACGGTTTCCCATTACGCCATTGGAGAGGAGTGGGAGCGGTTGTCTGAC

GCTGGCTTTAAGCTCACATGCCAGTGCTTGGGCTTTGGCAGTGGTCATTTCAGATGCGATTCATCTA - UNI10378 - AATGGTGCCATGACAACGG

TGTCAACTACAAGATCGGAGAGAAGTGGGATCGGCAGGGAGAAAATGGCCAGCGGATGAGCTGCACATGCCTCGGGAATGGAAAGGGAGAATTCAAGTGT

GATCCCC - UNI11217 - ATGAAGCAACGTGCTATGACGATGGGAAGACCTACCATGTAGGAGAACAGTGGCAGAAAGAATATCTCGGAGCCATTTG

CTCCTGCACGTGTTTCGGAGGCCAGCGG - UNI6951 - GGCTGGCGCTGTGACAACTGCCGTAGACCTGGGGCTGCTGAACCCAGTCCCGATGGCAC

CACCGGCCACACCTACAACCAGTATACACAGAGATACAATCAGAGAACAAACACT AACGTAAATTGCCCCATTGAGTGCTTCATGCCGCTAGATGTGCA

AGCTGACAGAGACGATTCTCGAGAGTAATCTTTCCAGCCCCACCCTACAAGTGTCTCTCTACCAAGGTCAATCCACACCCCAGTGATGTTAGCAGACCCT

CCATCTTTGAGTGGTCCTTTCACCCTTAAGCCTTTTGCTCTGGAGCCATGTTCTCAGCTTCAGCACAATTTACAGCTTCTCCAAGCATCGCCCCGTGGGA

TGTTTTGAGACTTCTCTCCTCAATGGTGACAGTTGGTCACCCTGTTCTGCTTCAGGGTTTCAGTACTGCTCAGTGTTGTTTAAGAGAATCAAAAGTTCTT

ATGGTTTGGTCTGGGATCAATAGGGAAACACAGGTAGCCAACTAGGAGGAAATGTACTGAATGCTAGTACCCAAGACCTTGAGCAGGAAAGTCACCCAGA

CACCTCTGCTTTCTTTTGCCATCTGACCTGCAGCACTGTCAGGACATGGCCTGTGGCTGTGTGTTCAAACACCCCTCCCACAGGACTCACTTTGTCCCAA

CAATTCAGATTGCCTAGAAATACCTTTCTCTTACCTGTTTGTTATTTATCAATTTTTCCCAGTATTTTTATACGGAAAAAATTGTATTGAAGACACTTTG

TATGCAGTTGATAAGAGGAATTCAGTATAATTATGGTTGGTGATTATTTTTATAAGCACATGCCAACGCTTTACTACTGTGGAAAGACAAGTGTTTTAAT

AAAAAGATTTACATTCCATG
Translation
MLRGPGPGRLLLLAVLCLGTSVRCTEAGKSKRQAQQIVQPQSPVAVSQSKP - UNI29586 - PGCFDNGKHYQINQQWERTYLGNALVCTCYGGSRG

FNCESKPEP - UNI10547 - - UNI29586 - PEETCFDKYTGNTYKVGDTYERPKDSMIWDCTCIGAGRGRISCTIAN - UNI10563 - NRC

HEGGQSYKIGDKWRRPHETGGYMLECLCLGNGKGEWTCKPIA - UNI11231 - AEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGNGRITCT

SRN - UNI8476 - NRCNDQDTRTSYRIGDTWSKKDNRGNLLQCVCTGNGRGEWKCERHALQSASAG - UNI9139 - GSGSFTDVRTAIYQPQTH

PQPAPYGHCVTDSGVVYSVGMQWLKSQGNKQMLCTCLGNGVSCQETA AVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQK

YSFCTDHAV VLVQTRGGNSNGALCHFPFLYNNRNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAA AHEEICTTNEGVMYRIGDQWDKQHDLGHM

MRCTCVGNGRGEWACIPYSQLRD DQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPID DQCQDSETRTFYQIGDSWEKFVHGVRYQCYC

YGRGIGEWHCQPLQTYPG - UNI11300 - GTTGPVQVIITETPSQPNSHPIQWNAPEPSHITKYILRWRP KTSTGRWKEATIPGHLNSYTIKGLTP

GVIYEGQLISIQQYGHREVTRFDFTTSASTPVTS SNTVTGETAPYSPVVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLD DLPS

TATSVNIPDLLPGRKYIVNVYQISEEGKQSLILSTSQTTA APDAPPDPTVDQVDDTSIVVRWSRPQAPITG GYRIVYSPSVEGSSTELNLPETANSVT

LSDLQPGVQYNITIYAVEENQESTPVFIQQETTGTPRSD DNVPPPTDLQFVELTDVKVTIMWTPPDSVVSGYRVEVLPVSLPGEHGQRLPVNRNTFAEI

TGLSPGVTYLFKVFAVHQGRESNPLTAQQTTK KLDAPTNLQFVNETDRTVLVTWTPPRARIAGYRLTAGLTRGGQPKQYNVGPLASKYPLRNLQPGSEY

TVTLVAVKGNQQSPKATGVFTTL - UNI10292 - LQPLRSIPPYNTEVTETTIVITWTPAPRIGFK LGVRPSQGGEAPREVTSDSGSIVVSGLTPG

VEYTYTIQVLRDGQERDAPIVNRVVTP PLSPPTNLHLEANPDTGVLTVSWERSTTPD DITGYRITTTPTNGQQGTSLEEVVHADQSSCTFENLNPGLE

YNVSVYTVKDDKESAPISDTVVPA - UNI10657 - AVPPPTDLRFTNIGPDTMRVTWAPPPSIELTNLLVRYSPVKNEEDVAELSISPSDNAVVLTN

 - UNI10319 - NLLPGTEYLVSVSSVYEQHESIPLRGRQKTG GLDSPTGFDSSDITANSFTVHWVAPRAPITGYIIRHHAEHSVGRPRQDRVPPSR

NSITLTNLNPGTEYVVSIIAVNGREESPPLIGQQATV - UNI27938 - VSDIPRDLEVIASTPTSLLISWEPPAVSVRYYRITYGETG GGNSPVQE

FTVPGSKSTATINNIKPGADYTITLYAVTGRGDSPASSKPVSINYKTE EIDKPSQMQVTDVQDNSISVRWLPSTSPVTGYRVTTTPKNGLGPSKTKTAS

PD DQTEMTIEGLQPTVEYVVSVYAQNRNGESQPLVQTAVTT - UNI9136 - TIPAPTNLKFSQVTPTSFTAQWIAPSVQLTGYRVRVNPKEKTGPM

KEINLSPDSSSVIVSGLM VATKYEVSVYALKDTLTSRPAQGVITTLEN NVSPPRRARVTDATETTITISWRTKTETITGFQVDAIPANGQTPVQRSIS

PDVRSYTITG GLQPGTDYKIHLYTLNDNARSSPVIIDASTA AIDAPSNLRFLTTTPNSLLVSWQAPRARITGYIIKYEKPGSPPREVVPRPRPGVTEA

TITG GLEPGTEYTIYVIALKNNQKSEPLIGRKKTD DELPQLVTLPHPNLHGPEILDVPSTVQKTPFITNPGYDTENGIQLPGTTHQQPSVGQQMIFEE

HGFRRTTPPTAATPVRLRPRPYLPNVDEEVQIGHVPRGDVDYHLYPHVPGLNPNASTGQEALSQTTISWTPFQESSEYIISCQPVGTDEEPLQ FQVPGT

STSATLTGLTRGVTYNIIVEALQNQRRHKVREEVVTVGNAV VSEGLNQPTDDSCFDPYTVSHYAIGEEWERLSDAGFKLTCQCLGFGSGHFRCDSSK -

 UNI10378 - KWCHDNGVNYKIGEKWDRQGENGQRMSCTCLGNGKGEFKCDPH - UNI11217 - HEATCYDDGKTYHVGEQWQKEYLGAICSCTC

FGGQR - UNI6951 - GWRCDNCRRPGAAEPSPDGTTGHTYNQYTQRYNQRTNT NVNCPIECFMPLDVQADRDDSRE
Transcript ENSMUST00000097700
Sequence
GCTCGCACCCGCTGCGCTGCACAGGGGGAGAAAAGGAGCCCAGGGTGTGAGCCGGACAACTTCTGGTCCTCTCCTTCCATCTCCTTACCGGCGTCCCCAC

CTCAGGACTTTTCCCGCAGGCTGCGAGGGGACCCACAGTTCGTGGCCACTTGCCTCCTGGGGAGGGCGACTCTCCTCCCATCCACTCAAGATGCTCAGGG

GTCCGGGACCCGGGCGGCTGCTGCTGCTGGCAGTCCTGTGCCTGGGGACCTCGGTGCGCTGCACCGAAGCCGGGAAGAGCAAGAGGCAGGCTCAGCAAAT

CGTGCAGCCTCAATCCCCGGTGGCTGTCAGTCAGAGCAAGC - UNI29586 - CTGGCTGTTTTGACAATGGGAAGCACTATCAGATAAATCAGCAGT

GGGAACGGACCTACCTAGGCAACGCCCTGGTTTGTACCTGCTATGGAGGAAGCCGGGGTTTTAACTGCGAGAGCAAGCCTGAGC - UNI10547 - - 

UNI29586 - CTGAAGAGACTTGCTTTGACAAATACACTGGGAACACTTACAAAGTGGGTGACACTTATGAGCGCCCTAAAGATTCCATGATCTGGGAC

TGTACCTGCATCGGGGCTGGGAGAGGCAGGATCAGCTGTACCATTGCAA - UNI10563 - ATCGCTGCCATGAAGGGGGTCAGTCCTACAAGATTGG

CGACAAGTGGAGGAGGCCACATGAGACTGGTGGCTACATGTTAGAGTGTCTGTGTCTGGGAAATGGAAAAGGGGAATGGACCTGCAAACCTATAG - UN

I11231 - CTGAGAAGTGTTTTGATCATGCTGCTGGGACGTCCTACGTCGTGGGGGAGACCTGGGAAAAGCCCTACCAAGGCTGGATGATGGTGGACTG

TACTTGTCTAGGCGAAGGCAATGGACGCATCACCTGTACCTCCAGAA - UNI8476 - ACAGATGCAACGATCAGGACACCCGGACATCCTATAGGAT

TGGAGACACGTGGAGCAAGAAGGACAACCGAGGAAACCTGCTTCAGTGTGTCTGCACAGGCAATGGCAGAGGGGAGTGGAAGTGTGAGCGACATGCTCTA

CAAAGTGCTTCAGCCG - UNI9139 - GATCTGGCTCCTTCACTGATGTCCGAACAGCTATTTACCAACCGCAGACTCACCCCCAGCCCGCTCCCTAC

GGCCACTGTGTCACCGACAGTGGTGTGGTCTACTCTGTGGGAATGCAGTGGCTGAAGTCGCAAGGAAACAAGCAAATGCTGTGCACGTGCCTGGGCAATG

GCGTCAGCTGCCAGGAGACAG CCGTGACCCAGACTTATGGTGGCAATTCAAACGGGGAGCCCTGTGTCCTCCCGTTCACCTACAACGGTAGGACCTTCT

ATTCCTGCACCACCGAAGGGCGGCAAGACGGACATCTGTGGTGTAGCACAACTTCCAATTACGAACAAGACCAGAAGTATTCCTTCTGCACAGACCATGC

GG TTTTGGTTCAGACTCGAGGCGGAAATTCCAATGGTGCTCTGTGCCACTTCCCCTTCCTGTACAACAACCGGAATTACACCGACTGTACTTCTGAGGG

TCGCAGGGACAACATGAAATGGTGCGGCACCACCCAGAACTACGATGCCGATCAGAAGTTTGGATTCTGCCCAATGGCTG CCCACGAGGAGATCTGCAC

AACCAATGAAGGGGTCATGTATCGCATTGGGGATCAGTGGGATAAGCAGCATGACCTGGGCCACATGATGAGGTGCACGTGTGTGGGGAACGGTCGTGGA

GAATGGGCCTGCATCCCCTACTCCCAGCTCCGAG ACCAGTGCATCGTTGATGACATTACTTACAATGTGAACGACACGTTCCACAAGCGTCACGAGGAG

GGACATATGCTGAACTGTACCTGCTTTGGTCAGGGCCGGGGCAGATGGAAGTGTGACCCCATTG ACCAGTGCCAAGATTCAGAGACCCGGACATTTTAC

CAGATTGGTGACTCCTGGGAGAAGTTTGTGCATGGTGTCCGATACCAGTGTTACTGCTACGGCCGTGGCATCGGGGAGTGGCACTGTCAACCTCTGCAGA

CCTACCCAG - UNI11300 - GCACAACTGGACCTGTCCAAGTAATTATCACGGAGACCCCCAGCCAGCCCAATTCCCACCCCATCCAGTGGAATGCC

CCGGAGCCTTCACACATCACCAAGTACATTCTCAGATGGAGACCT AAAACCTCTACGGGTCGCTGGAAGGAAGCTACCATTCCTGGCCACCTTAACTCC

TATACCATCAAAGGCCTGACCCCAGGTGTGATCTATGAGGGACAGCTCATCAGCATCCAGCAGTATGGCCACAGAGAAGTGACACGCTTCGACTTCACCA

CCAGCGCCAGCACCCCTGTGACCA GCAACACGGTGACCGGAGAGACTGCGCCCTACTCTCCTGTTGTGGCCACTTCTGAATCTGTAACTGAAATCACAG

CCAGCAGCTTTGTGGTCTCATGGGTCTCAGCCTCCGACACCGTGTCAGGCTTCCGGGTGGAGTATGAGCTGAGCGAGGAGGGAGATGAACCACAGTACCT

TG ATCTCCCAAGCACGGCCACTTCCGTGAACATTCCTGACCTGCTCCCGGGCAGAAAGTACATTGTCAATGTCTATCAGATATCTGAGGAGGGAAAACA

GAGCTTGATCCTGTCTACCTCACAGACTACAG CACCTGACGCTCCTCCAGACCCTACCGTGGACCAGGTTGATGATACTTCCATTGTTGTTCGGTGGAG

TAGACCCCAGGCACCTATCACAG GGTATAGAATTGTCTATTCACCTTCAGTAGAAGGCAGTAGCACAGAGCTCAACCTCCCTGAAACGGCCAACTCCGT

CACCCTCAGCGACCTGCAGCCCGGTGTTCAGTACAACATCACTATCTATGCTGTGGAGGAGAACCAGGAGAGCACACCCGTTTTCATCCAACAAGAGACC

ACTGGCACCCCAAGATCTG ATAACGTCCCCCCTCCGACGGACCTACAGTTTGTGGAACTGACTGATGTGAAAGTCACCATCATGTGGACCCCTCCTGAT

AGTGTGGTGTCTGGATACCGTGTGGAGGTCCTGCCTGTCAGCCTGCCCGGGGAACATGGGCAGAGGCTGCCTGTCAACAGAAATACCTTTGCTGAAATCA

CTGGGCTGTCCCCTGGGGTCACGTACCTCTTCAAAGTCTTTGCTGTGCACCAGGGCAGGGAAAGCAATCCTCTGACGGCACAACAGACCACCA AACTCG

ACGCTCCCACTAACCTCCAGTTTGTCAATGAAACTGACAGAACAGTTCTGGTAACGTGGACTCCACCTCGAGCCCGTATAGCAGGCTACCGACTGACCGC

GGGCCTGACCCGAGGAGGCCAGCCCAAGCAGTACAATGTGGGACCCTTGGCCTCCAAGTATCCCCTGAGAAATCTGCAGCCTGGGTCTGAGTACACCGTG

ACCTTGGTGGCTGTGAAAGGGAACCAGCAGAGTCCCAAAGCCACCGGAGTCTTTACTACCC - UNI10292 - TGCAGCCTCTGCGCTCCATTCCACC

TTACAACACCGAGGTGACAGAGACCACAATTGTGATCACCTGGACCCCCGCTCCAAGGATTGGCTTCAAG CTGGGTGTACGACCGAGCCAGGGAGGTGA

GGCACCCCGAGAAGTGACTTCAGACTCTGGGAGCATTGTTGTGTCTGGCTTGACTCCAGGCGTGGAATACACTTACACCATCCAAGTCCTGCGAGATGGC

CAGGAGAGAGATGCACCGATTGTCAACAGAGTAGTGACAC CGCTGTCTCCACCGACCAACTTGCATCTGGAGGCAAACCCTGACACTGGAGTGCTTACT

GTCTCCTGGGAGAGGAGCACTACCCCAG ATATCACTGGCTACAGAATAACTACTACCCCCACGAACGGGCAGCAGGGGACCTCTCTGGAAGAAGTGGTC

CATGCTGATCAGAGTTCCTGCACTTTTGAGAACCTGAATCCTGGCCTGGAGTACAACGTCAGTGTTTACACTGTCAAAGATGACAAGGAAAGTGCCCCTA

TCTCTGATACCGTTGTCCCAG - UNI10657 - CTGTCCCTCCTCCCACGGATCTGCGATTCACCAATATCGGTCCAGACACGATGCGGGTCACTTGG

GCCCCGCCTCCGTCCATCGAGCTGACCAACCTCTTGGTGCGCTACTCACCCGTGAAGAATGAAGAGGACGTTGCAGAGCTATCCATTTCACCTTCAGACA

ATGCCGTGGTCCTAACAA - UNI10319 - ATCTCCTGCCTGGGACAGAATACTTAGTCAGTGTCTCCAGTGTCTACGAACAACATGAGAGCATCCCT

CTCCGGGGAAGGCAGAAAACAG GTCTCGATTCCCCAACTGGTTTTGATTCTTCTGATATCACCGCCAACTCATTCACTGTCCACTGGGTGGCTCCTCGG

GCCCCCATCACCGGCTACATCATCCGCCATCACGCCGAGCATTCTGTCGGAAGACCCAGGCAGGATCGAGTGCCGCCCTCGCGGAATTCCATCACCCTCA

CCAACCTTAATCCGGGCACCGAGTACGTTGTCAGCATCATTGCTGTTAATGGCAGAGAGGAGAGCCCGCCACTGATTGGCCAGCAAGCCACAG - UNI2

7938 - TTTCTGATATTCCGAGAGATCTGGAGGTCATTGCCTCCACCCCCACCAGCCTGCTCATCAGTTGGGAACCCCCTGCCGTCTCTGTGCGCTATT

ACAGAATCACCTACGGAGAGACAG GAGGAAATAGCCCTGTCCAGGAGTTCACTGTGCCCGGAAGCAAGTCCACAGCCACCATCAACAACATTAAACCAG

GAGCAGACTACACCATCACCCTGTATGCTGTCACTGGCCGTGGGGACAGTCCAGCAAGCAGCAAGCCAGTTTCCATCAATTATAAAACAG AAATTGACA

AGCCGTCCCAGATGCAGGTGACAGATGTCCAGGACAACAGCATCAGTGTCAGGTGGCTGCCTTCAACTTCTCCTGTGACAGGCTACAGAGTGACCACCAC

TCCCAAAAATGGCCTAGGACCATCAAAAACTAAAACTGCCAGTCCAG ATCAAACAGAAATGACCATTGAAGGTTTGCAACCCACTGTGGAGTACGTGGT

TAGTGTTTATGCTCAGAACCGGAACGGAGAAAGCCAGCCCCTGGTTCAAACTGCAGTGACCA ACATTGATCGCCCTAAAGGACTGGCATTCACTGATGT

GGATGTCGATTCCATCAAAATTGCTTGGGAAAGCCCACAGGGGCAAGTTTCCAGGTACAGGGTGACCTACTCGAGCCCTGAGGATGGAATCCGGGAGCTT

TTCCCTGCACCTGATGGTGAAGACGACACTGCAGAGCTGCAGGGCCTCAGGCCGGGGTCTGAGTACACAGTCAGTGTGGTTGCCTTGCACGATGATATGG

AGAGCCAGCCCCTGATTGGAATCCAGTCCACAG - UNI9136 - CCATTCCTGCGCCCACCAATCTGAAGTTCAGTCAGGTGACACCCACCAGCTTTA

CTGCCCAGTGGATAGCACCCAGTGTTCAGCTCACTGGCTACCGGGTGCGGGTGAACCCGAAAGAGAAGACAGGACCAATGAAAGAAATCAACCTTTCTCC

AGACAGCTCATCGGTGATTGTGTCAGGACTCATG GTGGCCACTAAATACGAAGTCAGTGTCTATGCTCTCAAGGACACACTGACAAGCAGACCAGCCCA

GGGAGTCATCACTACTCTGGAGA ATGTTAGCCCTCCAAGAAGGGCCCGTGTGACGGACGCTACAGAGACCACCATCACTATTAGCTGGAGAACAAAGAC

AGAGACAATCACTGGCTTCCAAGTCGATGCCATCCCAGCCAATGGCCAGACCCCAGTTCAGAGGAGCATCAGCCCGGATGTTAGAAGCTACACCATTACA

G GTTTACAGCCAGGCACTGACTACAAGATCCACCTGTACACTCTGAACGACAATGCCCGGAGCTCGCCCGTGATCATCGATGCCTCCACCG CCATCGA

CGCACCATCCAACCTGCGGTTCCTGACCACCACACCCAACTCCTTGCTGGTGTCATGGCAGGCGCCCCGTGCCAGGATTACTGGCTACATTATCAAGTAT

GAGAAGCCTGGATCCCCTCCCAGAGAAGTGGTCCCTCGGCCCCGCCCTGGTGTCACGGAGGCCACCATTACTG GTCTGGAGCCAGGAACCGAGTACACC

ATCTACGTCATTGCCCTGAAGAACAATCAGAAGAGTGAGCCCCTGATTGGGAGGAAGAAGACAG TTCAAAAGACCCCCTTCATCACCAACCCTGGGTAT

GACACCGAAAATGGTATTCAGCTTCCTGGCACAACCCACCAGCAACCCAGTGTTGGGCAACAAATGATCTTTGAGGAACATGGCTTTAGGCGGACAACGC

CACCCACTGCGGCCACCCCCGTCAGGCTTAGGCCAAGACCATACCTGCCGAATGTAGATGAGGAGGTCCAAATCGGTCATGTTCCCAGGGGAGACGTAGA

CTACCACCTCTATCCTCATGTTCCGGGCCTCAATCCAAATGCCTCTACAGGACAGGAAGCTCTCTCTCAGACAACCATCTCTTGGACGCCGTTCCAGGAG

AGTTCTGAGTACATCATTTCATGCCAACCAGTTGGCACCGACGAAGAGCCCTTACAG TTCCAAGTTCCTGGAACTTCTACCAGTGCGACTCTGACTGGC

CTTACCAGAGGGGTCACCTACAACATCATAGTGGAGGCACTGCAGAACCAGAGGAGGCACAAGGTTCGGGAAGAGGTTGTGACTGTGGGCAACGCTG TC

AGCGAAGGCCTGAACCAGCCTACAGATGACTCATGCTTTGACCCTTACACGGTTTCCCATTACGCCATTGGAGAGGAGTGGGAGCGGTTGTCTGACGCTG

GCTTTAAGCTCACATGCCAGTGCTTGGGCTTTGGCAGTGGTCATTTCAGATGCGATTCATCTA - UNI10378 - AATGGTGCCATGACAACGGTGTC

AACTACAAGATCGGAGAGAAGTGGGATCGGCAGGGAGAAAATGGCCAGCGGATGAGCTGCACATGCCTCGGGAATGGAAAGGGAGAATTCAAGTGTGATC

CCC - UNI11217 - ATGAAGCAACGTGCTATGACGATGGGAAGACCTACCATGTAGGAGAACAGTGGCAGAAAGAATATCTCGGAGCCATTTGCTCC

TGCACGTGTTTCGGAGGCCAGCGG - UNI6951 - GGCTGGCGCTGTGACAACTGCCGTAGACCTGGGGCTGCTGAACCCAGTCCCGATGGCACCACC

GGCCACACCTACAACCAGTATACACAGAGATACAATCAGAGAACAAACACT AACGTAAATTGCCCCATTGAGTGCTTCATGCCGCTAGATGTGCAAGCT

GACAGAGACGATTCTCGAGAGTAATCTTTCCAGCCCCACCCTACAAGTGTCTCTCTACCAAGGTCAATCCACACCCCAGTGATGTTAGCAGACCCTCCAT

CTTTGAGTGGTCCTTTCACCCTTAAGCCTTTTGCTCTGGAGCCATGTTCTCAGCTTCAGCACAATTTACAGCTTCTCCAAGCATCGCCCCGTGGGATGTT

TTGAGACTTCTCTCCTCAATGGTGACAGTTGGTCACCCTGTTCTGCTTCAGGGTTTCAGTACTGCTCAGTGTTGTTTAAGAGAATCAAAAGTTCTTATGG

TTTGGTCTGGGATCAATAGGGAAACACAGGTAGCCAACTAGGAGGAAATGTACTGAATGCTAGTACCCAAGACCTTGAGCAGGAAAGTCACCCAGACACC

TCTGCTTTCTTTTGCCATCTGACCTGCAGCACTGTCAGGACATGGCCTGTGGCTGTGTGTTCAAACACCCCTCCCACAGGACTCACTTTGTCCCAACAAT

TCAGATTGCCTAGAAATACCTTTCTCTTACCTGTTTGTTATTTATCAATTTTTCCCAGTATTTTTATACGGAAAAAATTGTATTGAAGACACTTTGTATG

CAGTTGATAAGAGGAATTCAGTATAATTATGGTTGGTGATTATTTTTATAAGCACATGCCAACGCTTTACTACTGTGGAAAGACAAGTGTTTTAATAAAA

AGATTTACATTCCATG
Translation
MLRGPGPGRLLLLAVLCLGTSVRCTEAGKSKRQAQQIVQPQSPVAVSQSKP - UNI29586 - PGCFDNGKHYQINQQWERTYLGNALVCTCYGGSRG

FNCESKPEP - UNI10547 - - UNI29586 - PEETCFDKYTGNTYKVGDTYERPKDSMIWDCTCIGAGRGRISCTIAN - UNI10563 - NRC

HEGGQSYKIGDKWRRPHETGGYMLECLCLGNGKGEWTCKPIA - UNI11231 - AEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGNGRITCT

SRN - UNI8476 - NRCNDQDTRTSYRIGDTWSKKDNRGNLLQCVCTGNGRGEWKCERHALQSASAG - UNI9139 - GSGSFTDVRTAIYQPQTH

PQPAPYGHCVTDSGVVYSVGMQWLKSQGNKQMLCTCLGNGVSCQETA AVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQK

YSFCTDHAV VLVQTRGGNSNGALCHFPFLYNNRNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAA AHEEICTTNEGVMYRIGDQWDKQHDLGHM

MRCTCVGNGRGEWACIPYSQLRD DQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPID DQCQDSETRTFYQIGDSWEKFVHGVRYQCYC

YGRGIGEWHCQPLQTYPG - UNI11300 - GTTGPVQVIITETPSQPNSHPIQWNAPEPSHITKYILRWRP KTSTGRWKEATIPGHLNSYTIKGLTP

GVIYEGQLISIQQYGHREVTRFDFTTSASTPVTS SNTVTGETAPYSPVVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLD DLPS

TATSVNIPDLLPGRKYIVNVYQISEEGKQSLILSTSQTTA APDAPPDPTVDQVDDTSIVVRWSRPQAPITG GYRIVYSPSVEGSSTELNLPETANSVT

LSDLQPGVQYNITIYAVEENQESTPVFIQQETTGTPRSD DNVPPPTDLQFVELTDVKVTIMWTPPDSVVSGYRVEVLPVSLPGEHGQRLPVNRNTFAEI

TGLSPGVTYLFKVFAVHQGRESNPLTAQQTTK KLDAPTNLQFVNETDRTVLVTWTPPRARIAGYRLTAGLTRGGQPKQYNVGPLASKYPLRNLQPGSEY

TVTLVAVKGNQQSPKATGVFTTL - UNI10292 - LQPLRSIPPYNTEVTETTIVITWTPAPRIGFK LGVRPSQGGEAPREVTSDSGSIVVSGLTPG

VEYTYTIQVLRDGQERDAPIVNRVVTP PLSPPTNLHLEANPDTGVLTVSWERSTTPD DITGYRITTTPTNGQQGTSLEEVVHADQSSCTFENLNPGLE

YNVSVYTVKDDKESAPISDTVVPA - UNI10657 - AVPPPTDLRFTNIGPDTMRVTWAPPPSIELTNLLVRYSPVKNEEDVAELSISPSDNAVVLTN

 - UNI10319 - NLLPGTEYLVSVSSVYEQHESIPLRGRQKTG GLDSPTGFDSSDITANSFTVHWVAPRAPITGYIIRHHAEHSVGRPRQDRVPPSR

NSITLTNLNPGTEYVVSIIAVNGREESPPLIGQQATV - UNI27938 - VSDIPRDLEVIASTPTSLLISWEPPAVSVRYYRITYGETG GGNSPVQE

FTVPGSKSTATINNIKPGADYTITLYAVTGRGDSPASSKPVSINYKTE EIDKPSQMQVTDVQDNSISVRWLPSTSPVTGYRVTTTPKNGLGPSKTKTAS

PD DQTEMTIEGLQPTVEYVVSVYAQNRNGESQPLVQTAVTN NIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIRELFPAPDGEDDTA

ELQGLRPGSEYTVSVVALHDDMESQPLIGIQSTA - UNI9136 - AIPAPTNLKFSQVTPTSFTAQWIAPSVQLTGYRVRVNPKEKTGPMKEINLSPD

SSSVIVSGLM VATKYEVSVYALKDTLTSRPAQGVITTLEN NVSPPRRARVTDATETTITISWRTKTETITGFQVDAIPANGQTPVQRSISPDVRSYTI

TG GLQPGTDYKIHLYTLNDNARSSPVIIDASTA AIDAPSNLRFLTTTPNSLLVSWQAPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITG GLE

PGTEYTIYVIALKNNQKSEPLIGRKKTV VQKTPFITNPGYDTENGIQLPGTTHQQPSVGQQMIFEEHGFRRTTPPTAATPVRLRPRPYLPNVDEEVQIG

HVPRGDVDYHLYPHVPGLNPNASTGQEALSQTTISWTPFQESSEYIISCQPVGTDEEPLQ FQVPGTSTSATLTGLTRGVTYNIIVEALQNQRRHKVREE

VVTVGNAV VSEGLNQPTDDSCFDPYTVSHYAIGEEWERLSDAGFKLTCQCLGFGSGHFRCDSSK - UNI10378 - KWCHDNGVNYKIGEKWDRQGE

NGQRMSCTCLGNGKGEFKCDPH - UNI11217 - HEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQR - UNI6951 - GWRCDNCRRPGAAEP

SPDGTTGHTYNQYTQRYNQRTNT NVNCPIECFMPLDVQADRDDSRE
Transcript ENSMUST00000055226
Sequence
GCTCGCACCCGCTGCGCTGCACAGGGGGAGAAAAGGAGCCCAGGGTGTGAGCCGGACAACTTCTGGTCCTCTCCTTCCATCTCCTTACCGGCGTCCCCAC

CTCAGGACTTTTCCCGCAGGCTGCGAGGGGACCCACAGTTCGTGGCCACTTGCCTCCTGGGGAGGGCGACTCTCCTCCCATCCACTCAAGATGCTCAGGG

GTCCGGGACCCGGGCGGCTGCTGCTGCTGGCAGTCCTGTGCCTGGGGACCTCGGTGCGCTGCACCGAAGCCGGGAAGAGCAAGAGGCAGGCTCAGCAAAT

CGTGCAGCCTCAATCCCCGGTGGCTGTCAGTCAGAGCAAGC - UNI29586 - CTGGCTGTTTTGACAATGGGAAGCACTATCAGATAAATCAGCAGT

GGGAACGGACCTACCTAGGCAACGCCCTGGTTTGTACCTGCTATGGAGGAAGCCGGGGTTTTAACTGCGAGAGCAAGCCTGAGC - UNI10547 - - 

UNI29586 - CTGAAGAGACTTGCTTTGACAAATACACTGGGAACACTTACAAAGTGGGTGACACTTATGAGCGCCCTAAAGATTCCATGATCTGGGAC

TGTACCTGCATCGGGGCTGGGAGAGGCAGGATCAGCTGTACCATTGCAA - UNI10563 - ATCGCTGCCATGAAGGGGGTCAGTCCTACAAGATTGG

CGACAAGTGGAGGAGGCCACATGAGACTGGTGGCTACATGTTAGAGTGTCTGTGTCTGGGAAATGGAAAAGGGGAATGGACCTGCAAACCTATAG - UN

I11231 - CTGAGAAGTGTTTTGATCATGCTGCTGGGACGTCCTACGTCGTGGGGGAGACCTGGGAAAAGCCCTACCAAGGCTGGATGATGGTGGACTG

TACTTGTCTAGGCGAAGGCAATGGACGCATCACCTGTACCTCCAGAA - UNI8476 - ACAGATGCAACGATCAGGACACCCGGACATCCTATAGGAT

TGGAGACACGTGGAGCAAGAAGGACAACCGAGGAAACCTGCTTCAGTGTGTCTGCACAGGCAATGGCAGAGGGGAGTGGAAGTGTGAGCGACATGCTCTA

CAAAGTGCTTCAGCCG - UNI9139 - GATCTGGCTCCTTCACTGATGTCCGAACAGCTATTTACCAACCGCAGACTCACCCCCAGCCCGCTCCCTAC

GGCCACTGTGTCACCGACAGTGGTGTGGTCTACTCTGTGGGAATGCAGTGGCTGAAGTCGCAAGGAAACAAGCAAATGCTGTGCACGTGCCTGGGCAATG

GCGTCAGCTGCCAGGAGACAG CCGTGACCCAGACTTATGGTGGCAATTCAAACGGGGAGCCCTGTGTCCTCCCGTTCACCTACAACGGTAGGACCTTCT

ATTCCTGCACCACCGAAGGGCGGCAAGACGGACATCTGTGGTGTAGCACAACTTCCAATTACGAACAAGACCAGAAGTATTCCTTCTGCACAGACCATGC

GG TTTTGGTTCAGACTCGAGGCGGAAATTCCAATGGTGCTCTGTGCCACTTCCCCTTCCTGTACAACAACCGGAATTACACCGACTGTACTTCTGAGGG

TCGCAGGGACAACATGAAATGGTGCGGCACCACCCAGAACTACGATGCCGATCAGAAGTTTGGATTCTGCCCAATGGCTG CCCACGAGGAGATCTGCAC

AACCAATGAAGGGGTCATGTATCGCATTGGGGATCAGTGGGATAAGCAGCATGACCTGGGCCACATGATGAGGTGCACGTGTGTGGGGAACGGTCGTGGA

GAATGGGCCTGCATCCCCTACTCCCAGCTCCGAG ACCAGTGCATCGTTGATGACATTACTTACAATGTGAACGACACGTTCCACAAGCGTCACGAGGAG

GGACATATGCTGAACTGTACCTGCTTTGGTCAGGGCCGGGGCAGATGGAAGTGTGACCCCATTG ACCAGTGCCAAGATTCAGAGACCCGGACATTTTAC

CAGATTGGTGACTCCTGGGAGAAGTTTGTGCATGGTGTCCGATACCAGTGTTACTGCTACGGCCGTGGCATCGGGGAGTGGCACTGTCAACCTCTGCAGA

CCTACCCAG - UNI11300 - GCACAACTGGACCTGTCCAAGTAATTATCACGGAGACCCCCAGCCAGCCCAATTCCCACCCCATCCAGTGGAATGCC

CCGGAGCCTTCACACATCACCAAGTACATTCTCAGATGGAGACCT AAAACCTCTACGGGTCGCTGGAAGGAAGCTACCATTCCTGGCCACCTTAACTCC

TATACCATCAAAGGCCTGACCCCAGGTGTGATCTATGAGGGACAGCTCATCAGCATCCAGCAGTATGGCCACAGAGAAGTGACACGCTTCGACTTCACCA

CCAGCGCCAGCACCCCTGTGACCA GCAACACGGTGACCGGAGAGACTGCGCCCTACTCTCCTGTTGTGGCCACTTCTGAATCTGTAACTGAAATCACAG

CCAGCAGCTTTGTGGTCTCATGGGTCTCAGCCTCCGACACCGTGTCAGGCTTCCGGGTGGAGTATGAGCTGAGCGAGGAGGGAGATGAACCACAGTACCT

TG ATCTCCCAAGCACGGCCACTTCCGTGAACATTCCTGACCTGCTCCCGGGCAGAAAGTACATTGTCAATGTCTATCAGATATCTGAGGAGGGAAAACA

GAGCTTGATCCTGTCTACCTCACAGACTACAG CACCTGACGCTCCTCCAGACCCTACCGTGGACCAGGTTGATGATACTTCCATTGTTGTTCGGTGGAG

TAGACCCCAGGCACCTATCACAG GGTATAGAATTGTCTATTCACCTTCAGTAGAAGGCAGTAGCACAGAGCTCAACCTCCCTGAAACGGCCAACTCCGT

CACCCTCAGCGACCTGCAGCCCGGTGTTCAGTACAACATCACTATCTATGCTGTGGAGGAGAACCAGGAGAGCACACCCGTTTTCATCCAACAAGAGACC

ACTGGCACCCCAAGATCTG ATAACGTCCCCCCTCCGACGGACCTACAGTTTGTGGAACTGACTGATGTGAAAGTCACCATCATGTGGACCCCTCCTGAT

AGTGTGGTGTCTGGATACCGTGTGGAGGTCCTGCCTGTCAGCCTGCCCGGGGAACATGGGCAGAGGCTGCCTGTCAACAGAAATACCTTTGCTGAAATCA

CTGGGCTGTCCCCTGGGGTCACGTACCTCTTCAAAGTCTTTGCTGTGCACCAGGGCAGGGAAAGCAATCCTCTGACGGCACAACAGACCACCA AACTCG

ACGCTCCCACTAACCTCCAGTTTGTCAATGAAACTGACAGAACAGTTCTGGTAACGTGGACTCCACCTCGAGCCCGTATAGCAGGCTACCGACTGACCGC

GGGCCTGACCCGAGGAGGCCAGCCCAAGCAGTACAATGTGGGACCCTTGGCCTCCAAGTATCCCCTGAGAAATCTGCAGCCTGGGTCTGAGTACACCGTG

ACCTTGGTGGCTGTGAAAGGGAACCAGCAGAGTCCCAAAGCCACCGGAGTCTTTACTACCC - UNI10292 - TGCAGCCTCTGCGCTCCATTCCACC

TTACAACACCGAGGTGACAGAGACCACAATTGTGATCACCTGGACCCCCGCTCCAAGGATTGGCTTCAAG CTGGGTGTACGACCGAGCCAGGGAGGTGA

GGCACCCCGAGAAGTGACTTCAGACTCTGGGAGCATTGTTGTGTCTGGCTTGACTCCAGGCGTGGAATACACTTACACCATCCAAGTCCTGCGAGATGGC

CAGGAGAGAGATGCACCGATTGTCAACAGAGTAGTGACAC CGCTGTCTCCACCGACCAACTTGCATCTGGAGGCAAACCCTGACACTGGAGTGCTTACT

GTCTCCTGGGAGAGGAGCACTACCCCAG ATATCACTGGCTACAGAATAACTACTACCCCCACGAACGGGCAGCAGGGGACCTCTCTGGAAGAAGTGGTC

CATGCTGATCAGAGTTCCTGCACTTTTGAGAACCTGAATCCTGGCCTGGAGTACAACGTCAGTGTTTACACTGTCAAAGATGACAAGGAAAGTGCCCCTA

TCTCTGATACCGTTGTCCCAG - UNI10657 - AGGTGCCCCAGCTCACTGACCTAAGCTTTGTTGATATAACTGATTCAAGCATCGGCCTGAGGTGG

ACCCCGCTAAACTCTTCCACCATTATCGGGTACCGAATCACAGTAGTTGCGGCAGGAGAAGGGATCCCTATTTTTGAAGATTTTGTGGACTCCTCAGTAG

GATACTACACAGTTACAGGGCTGGAGCCTGGCATTGACTATGACATCAGCGTTATCACTCTCATTAATGGCGGAGAGAGTGCCCCTACTACACTGACACA

GCAAACGG CTGTCCCTCCTCCCACGGATCTGCGATTCACCAATATCGGTCCAGACACGATGCGGGTCACTTGGGCCCCGCCTCCGTCCATCGAGCTGAC

CAACCTCTTGGTGCGCTACTCACCCGTGAAGAATGAAGAGGACGTTGCAGAGCTATCCATTTCACCTTCAGACAATGCCGTGGTCCTAACAA - UNI10

319 - ATCTCCTGCCTGGGACAGAATACTTAGTCAGTGTCTCCAGTGTCTACGAACAACATGAGAGCATCCCTCTCCGGGGAAGGCAGAAAACAG GTC

TCGATTCCCCAACTGGTTTTGATTCTTCTGATATCACCGCCAACTCATTCACTGTCCACTGGGTGGCTCCTCGGGCCCCCATCACCGGCTACATCATCCG

CCATCACGCCGAGCATTCTGTCGGAAGACCCAGGCAGGATCGAGTGCCGCCCTCGCGGAATTCCATCACCCTCACCAACCTTAATCCGGGCACCGAGTAC

GTTGTCAGCATCATTGCTGTTAATGGCAGAGAGGAGAGCCCGCCACTGATTGGCCAGCAAGCCACAG - UNI27938 - TTTCTGATATTCCGAGAGA

TCTGGAGGTCATTGCCTCCACCCCCACCAGCCTGCTCATCAGTTGGGAACCCCCTGCCGTCTCTGTGCGCTATTACAGAATCACCTACGGAGAGACAG G

AGGAAATAGCCCTGTCCAGGAGTTCACTGTGCCCGGAAGCAAGTCCACAGCCACCATCAACAACATTAAACCAGGAGCAGACTACACCATCACCCTGTAT

GCTGTCACTGGCCGTGGGGACAGTCCAGCAAGCAGCAAGCCAGTTTCCATCAATTATAAAACAG AAATTGACAAGCCGTCCCAGATGCAGGTGACAGAT

GTCCAGGACAACAGCATCAGTGTCAGGTGGCTGCCTTCAACTTCTCCTGTGACAGGCTACAGAGTGACCACCACTCCCAAAAATGGCCTAGGACCATCAA

AAACTAAAACTGCCAGTCCAG ATCAAACAGAAATGACCATTGAAGGTTTGCAACCCACTGTGGAGTACGTGGTTAGTGTTTATGCTCAGAACCGGAACG

GAGAAAGCCAGCCCCTGGTTCAAACTGCAGTGACCA ACATTGATCGCCCTAAAGGACTGGCATTCACTGATGTGGATGTCGATTCCATCAAAATTGCTT

GGGAAAGCCCACAGGGGCAAGTTTCCAGGTACAGGGTGACCTACTCGAGCCCTGAGGATGGAATCCGGGAGCTTTTCCCTGCACCTGATGGTGAAGACGA

CACTGCAGAGCTGCAGGGCCTCAGGCCGGGGTCTGAGTACACAGTCAGTGTGGTTGCCTTGCACGATGATATGGAGAGCCAGCCCCTGATTGGAATCCAG

TCCACAG - UNI9136 - CCATTCCTGCGCCCACCAATCTGAAGTTCAGTCAGGTGACACCCACCAGCTTTACTGCCCAGTGGATAGCACCCAGTGTT

CAGCTCACTGGCTACCGGGTGCGGGTGAACCCGAAAGAGAAGACAGGACCAATGAAAGAAATCAACCTTTCTCCAGACAGCTCATCGGTGATTGTGTCAG

GACTCATG GTGGCCACTAAATACGAAGTCAGTGTCTATGCTCTCAAGGACACACTGACAAGCAGACCAGCCCAGGGAGTCATCACTACTCTGGAGA AT

GTTAGCCCTCCAAGAAGGGCCCGTGTGACGGACGCTACAGAGACCACCATCACTATTAGCTGGAGAACAAAGACAGAGACAATCACTGGCTTCCAAGTCG

ATGCCATCCCAGCCAATGGCCAGACCCCAGTTCAGAGGAGCATCAGCCCGGATGTTAGAAGCTACACCATTACAG GTTTACAGCCAGGCACTGACTACA

AGATCCACCTGTACACTCTGAACGACAATGCCCGGAGCTCGCCCGTGATCATCGATGCCTCCACCG CCATCGACGCACCATCCAACCTGCGGTTCCTGA

CCACCACACCCAACTCCTTGCTGGTGTCATGGCAGGCGCCCCGTGCCAGGATTACTGGCTACATTATCAAGTATGAGAAGCCTGGATCCCCTCCCAGAGA

AGTGGTCCCTCGGCCCCGCCCTGGTGTCACGGAGGCCACCATTACTG GTCTGGAGCCAGGAACCGAGTACACCATCTACGTCATTGCCCTGAAGAACAA

TCAGAAGAGTGAGCCCCTGATTGGGAGGAAGAAGACAG ATGAGCTTCCCCAACTGGTTACCCTTCCACACCCCAATCTTCATGGACCAGAGATCTTGGA

TGTTCCCTCCACAGTTCAAAAGACCCCCTTCATCACCAACCCTGGGTATGACACCGAAAATGGTATTCAGCTTCCTGGCACAACCCACCAGCAACCCAGT

GTTGGGCAACAAATGATCTTTGAGGAACATGGCTTTAGGCGGACAACGCCACCCACTGCGGCCACCCCCGTCAGGCTTAGGCCAAGACCATACCTGCCGA

ATGTAGATGAGGAGGTCCAAATCGGTCATGTTCCCAGGGGAGACGTAGACTACCACCTCTATCCTCATGTTCCGGGCCTCAATCCAAATGCCTCTACAGG

ACAGGAAGCTCTCTCTCAGACAACCATCTCTTGGACGCCGTTCCAGGAGAGTTCTGAGTACATCATTTCATGCCAACCAGTTGGCACCGACGAAGAGCCC

TTACAG TTCCAAGTTCCTGGAACTTCTACCAGTGCGACTCTGACTGGCCTTACCAGAGGGGTCACCTACAACATCATAGTGGAGGCACTGCAGAACCAG

AGGAGGCACAAGGTTCGGGAAGAGGTTGTGACTGTGGGCAACGCTG TCAGCGAAGGCCTGAACCAGCCTACAGATGACTCATGCTTTGACCCTTACACG

GTTTCCCATTACGCCATTGGAGAGGAGTGGGAGCGGTTGTCTGACGCTGGCTTTAAGCTCACATGCCAGTGCTTGGGCTTTGGCAGTGGTCATTTCAGAT

GCGATTCATCTA - UNI10378 - AATGGTGCCATGACAACGGTGTCAACTACAAGATCGGAGAGAAGTGGGATCGGCAGGGAGAAAATGGCCAGCGG

ATGAGCTGCACATGCCTCGGGAATGGAAAGGGAGAATTCAAGTGTGATCCCC - UNI11217 - ATGAAGCAACGTGCTATGACGATGGGAAGACCTA

CCATGTAGGAGAACAGTGGCAGAAAGAATATCTCGGAGCCATTTGCTCCTGCACGTGTTTCGGAGGCCAGCGG - UNI6951 - GGCTGGCGCTGTGA

CAACTGCCGTAGACCTGGGGCTGCTGAACCCAGTCCCGATGGCACCACCGGCCACACCTACAACCAGTATACACAGAGATACAATCAGAGAACAAACACT

 AACGTAAATTGCCCCATTGAGTGCTTCATGCCGCTAGATGTGCAAGCTGACAGAGACGATTCTCGAGAGTAATCTTTCCAGCCCCACCCTACAAGTGTC

TCTCTACCAAGGTCAATCCACACCCCAGTGATGTTAGCAGACCCTCCATCTTTGAGTGGTCCTTTCACCCTTAAGCCTTTTGCTCTGGAGCCATGTTCTC

AGCTTCAGCACAATTTACAGCTTCTCCAAGCATCGCCCCGTGGGATGTTTTGAGACTTCTCTCCTCAATGGTGACAGTTGGTCACCCTGTTCTGCTTCAG

GGTTTCAGTACTGCTCAGTGTTGTTTAAGAGAATCAAAAGTTCTTATGGTTTGGTCTGGGATCAATAGGGAAACACAGGTAGCCAACTAGGAGGAAATGT

ACTGAATGCTAGTACCCAAGACCTTGAGCAGGAAAGTCACCCAGACACCTCTGCTTTCTTTTGCCATCTGACCTGCAGCACTGTCAGGACATGGCCTGTG

GCTGTGTGTTCAAACACCCCTCCCACAGGACTCACTTTGTCCCAACAATTCAGATTGCCTAGAAATACCTTTCTCTTACCTGTTTGTTATTTATCAATTT

TTCCCAGTATTTTTATACGGAAAAAATTGTATTGAAGACACTTTGTATGCAGTTGATAAGAGGAATTCAGTATAATTATGGTTGGTGATTATTTTTATAA

GCACATGCCAACGCTTTACTACTGTGGAAAGACAAGTGTTTTAATAAAAAGATTTACATTCCATG
Translation
MLRGPGPGRLLLLAVLCLGTSVRCTEAGKSKRQAQQIVQPQSPVAVSQSKP - UNI29586 - PGCFDNGKHYQINQQWERTYLGNALVCTCYGGSRG

FNCESKPEP - UNI10547 - - UNI29586 - PEETCFDKYTGNTYKVGDTYERPKDSMIWDCTCIGAGRGRISCTIAN - UNI10563 - NRC

HEGGQSYKIGDKWRRPHETGGYMLECLCLGNGKGEWTCKPIA - UNI11231 - AEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGNGRITCT

SRN - UNI8476 - NRCNDQDTRTSYRIGDTWSKKDNRGNLLQCVCTGNGRGEWKCERHALQSASAG - UNI9139 - GSGSFTDVRTAIYQPQTH

PQPAPYGHCVTDSGVVYSVGMQWLKSQGNKQMLCTCLGNGVSCQETA AVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQK

YSFCTDHAV VLVQTRGGNSNGALCHFPFLYNNRNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAA AHEEICTTNEGVMYRIGDQWDKQHDLGHM

MRCTCVGNGRGEWACIPYSQLRD DQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPID DQCQDSETRTFYQIGDSWEKFVHGVRYQCYC

YGRGIGEWHCQPLQTYPG - UNI11300 - GTTGPVQVIITETPSQPNSHPIQWNAPEPSHITKYILRWRP KTSTGRWKEATIPGHLNSYTIKGLTP

GVIYEGQLISIQQYGHREVTRFDFTTSASTPVTS SNTVTGETAPYSPVVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLD DLPS

TATSVNIPDLLPGRKYIVNVYQISEEGKQSLILSTSQTTA APDAPPDPTVDQVDDTSIVVRWSRPQAPITG GYRIVYSPSVEGSSTELNLPETANSVT

LSDLQPGVQYNITIYAVEENQESTPVFIQQETTGTPRSD DNVPPPTDLQFVELTDVKVTIMWTPPDSVVSGYRVEVLPVSLPGEHGQRLPVNRNTFAEI

TGLSPGVTYLFKVFAVHQGRESNPLTAQQTTK KLDAPTNLQFVNETDRTVLVTWTPPRARIAGYRLTAGLTRGGQPKQYNVGPLASKYPLRNLQPGSEY

TVTLVAVKGNQQSPKATGVFTTL - UNI10292 - LQPLRSIPPYNTEVTETTIVITWTPAPRIGFK LGVRPSQGGEAPREVTSDSGSIVVSGLTPG

VEYTYTIQVLRDGQERDAPIVNRVVTP PLSPPTNLHLEANPDTGVLTVSWERSTTPD DITGYRITTTPTNGQQGTSLEEVVHADQSSCTFENLNPGLE

YNVSVYTVKDDKESAPISDTVVPE - UNI10657 - EVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTG

LEPGIDYDISVITLINGGESAPTTLTQQTA AVPPPTDLRFTNIGPDTMRVTWAPPPSIELTNLLVRYSPVKNEEDVAELSISPSDNAVVLTN - UNI1

0319 - NLLPGTEYLVSVSSVYEQHESIPLRGRQKTG GLDSPTGFDSSDITANSFTVHWVAPRAPITGYIIRHHAEHSVGRPRQDRVPPSRNSITLTN

LNPGTEYVVSIIAVNGREESPPLIGQQATV - UNI27938 - VSDIPRDLEVIASTPTSLLISWEPPAVSVRYYRITYGETG GGNSPVQEFTVPGSK

STATINNIKPGADYTITLYAVTGRGDSPASSKPVSINYKTE EIDKPSQMQVTDVQDNSISVRWLPSTSPVTGYRVTTTPKNGLGPSKTKTASPD DQTE

MTIEGLQPTVEYVVSVYAQNRNGESQPLVQTAVTN NIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIRELFPAPDGEDDTAELQGLRP

GSEYTVSVVALHDDMESQPLIGIQSTA - UNI9136 - AIPAPTNLKFSQVTPTSFTAQWIAPSVQLTGYRVRVNPKEKTGPMKEINLSPDSSSVIVS

GLM VATKYEVSVYALKDTLTSRPAQGVITTLEN NVSPPRRARVTDATETTITISWRTKTETITGFQVDAIPANGQTPVQRSISPDVRSYTITG GLQP

GTDYKIHLYTLNDNARSSPVIIDASTA AIDAPSNLRFLTTTPNSLLVSWQAPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITG GLEPGTEYTI

YVIALKNNQKSEPLIGRKKTD DELPQLVTLPHPNLHGPEILDVPSTVQKTPFITNPGYDTENGIQLPGTTHQQPSVGQQMIFEEHGFRRTTPPTAATPV

RLRPRPYLPNVDEEVQIGHVPRGDVDYHLYPHVPGLNPNASTGQEALSQTTISWTPFQESSEYIISCQPVGTDEEPLQ FQVPGTSTSATLTGLTRGVTY

NIIVEALQNQRRHKVREEVVTVGNAV VSEGLNQPTDDSCFDPYTVSHYAIGEEWERLSDAGFKLTCQCLGFGSGHFRCDSSK - UNI10378 - KWC

HDNGVNYKIGEKWDRQGENGQRMSCTCLGNGKGEFKCDPH - UNI11217 - HEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQR - UNI6951

 - GWRCDNCRRPGAAEPSPDGTTGHTYNQYTQRYNQRTNT NVNCPIECFMPLDVQADRDDSRE

For any suggestions or comments, please send an email to unitrap@crg.es