Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026255 (Efhd1)
Chromosomal location
Chr 1: 89160938 - 89207413 (+)
Description
EF hand domain containing 1 Gene [Source:MGI (curated);Acc:Efhd1-001]
RefSeq_dna
NM_028889 
RefSeq_peptide
NP_083165.1 
UniGene
Mm.247951 Mm.399025 
MGI
MGI:1921607 
Uniprot/SWISSPROT
Q9D4J1 
Human Ortholog
ENSG00000115468 (EFHD1)
Omim not available
UniTrap UNI27021
Vector Insertion
Chr 1: 89161330 - 89186042
Public Clones not available
Private Clones OST77927 (lexicon) OST74971 (lexicon)
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36348
Vector Insertion
Chr 1: 89186191 - 89194203
Public Clones IST11187C9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27152
Vector Insertion
Chr 1: 89194339 - 89206235
Public Clones not available
Private Clones OST68371 (lexicon)
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22832
Vector Insertion
Chr 1: 89206235 - 89207412
Public Clones PSTVUpb16d12 (vanderbilt)
Private Clones OST283579 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35348
Vector Insertion
Chr 1: 89206422 - 89206546
Public Clones IST14908D7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000118687
Sequence
AGAAAGCCACGAGCCCGCAAAGAGCGCACAACTCTCTGTCCCCGTACCGGATCGCGAACCTCAGTTCCATCACCACAACCCGCCATCATGTCCAGCGAGG

AGCTGGCCTGCAAGCTGCAGCGCCGGTTGAGACTTGAGGTGCGGGCAGAGACCGACCAGGGCGACCCCCAGCCTGCACCCTGCGATGCCCCAGCCGGGCA

CCCGGAGCCTGAACCGCCTGCCCGGGCGCCCACAGCCAGCGCGGACTCCGAACTGAACCTCAAGCTGAGCCGCAGGCTGGACATCCACCAGGGTACAGCG

CGGCCGGGCCGCTCTAAGGTCTTCAATCCCTACACCGAGTTCCCGGAGTTCAGCCGCCGCCTCCTGAAGGATCTGGAGAAGATGTTCAAAAC - UNI27

021 - GTATGATGCTGGAAGGGACGGCTTTATTGACCTGATGGAGCTGAAACTCATGATGGAGAAACTGGGGGCCCCTCAGACCCACCTGGGCCTGAAG

AGCATGATCAAGGAGGTGGATGAGGACTTCGACGGGAAGCTCAGCTTCCGGGAG - UNI36348 - TTCCTGCTCATTTTCCACAAGGCTGCTGCTGG

TGAGCTGCAGGAGGACAGTGGGTTGCTGGCACTGGCCAAGTTTTCCGAGATTGATGTCGCCCTGGAAGGTGTCAGAGGTGCCAAGAACTTCTTCGAAGCC

AAG - UNI22832 - - UNI27152 - GCCCAGGCCTTGTCATGTTCCAGTAAGTTCGAAGCTGAGTTAAAAGCTGAGCAAGAAGAGCGGAAACGGG

AGGAGGAGGCCCGGAGGCTCCGCCAGGCAGCCTTCCGGGAGCTCAAGGCAGCTTTCAGCGCGTAGTCCTGCTGACCTGACCTTTGACCGCGGCTGTGCCT

TACTAACACCCTGGAG - UNI22832 - - UNI35348 - GGTCCTGGTCCCTTCCAAACGGTTTGCCAGCCAGCCTTTCCAGCCTTCACCCCTCTG

CTGTTATCTGTAGATTCGTTTCTTCTTGGAAACCTTATTTATCCCTGCGGAGTCCTATGTCAACTCCTGTTCATCTACGGTTCTCAGAGGACATGTTGCC

TGTCGGCCCCGGGTAGTTTTTCCTTTGTGTTCCTTGTATTGTTTCCTGGTCAGCGTCTGTCTGCCTTCTTGTTATTACCCAGATTCCATTGACTTCTTTT

TCACCGTCTTCCACGCTAGTGTGATGATGGGATTTGAAGGAGCACTTGTGGATCAATACCAATATCCCCTCACCAACCAGGGACTAGTTTGATGCTATCT

TTGCCTGTCTCTTGGCTCTTAACAATGCCTACCCTCTTGTTCCCCCTCGTTCATTTCCCAGTCCAGCCATTTTCCCACTCCTAAGTTCTTTACTGTTAAG

AATGAGAGAATCGTCAGAAGTAATATTAGTGAGTAGAAGGATAGCTGTCACCCGACCCCATTCAAATCAGAGTGGACCTGTGAAACTCTCAAGTGACATC

CAAGGTCTTTTGAAATCATGACCAAATTCCCGTGTCTGACAACAGTTCCAGAGAACTGAAAGAAATGTATTCTCGCCCATGAGACAGATTTTTGTATCTT

GAGTTTCTTGGGACTTCTCACAAATACCTGGGGAGGGGGGTTATGTATTTTTTAACAAAACCAAAACCAAAAATTCTTAATGTCATATTTATTTGACTTG

TAACTTGTAACTCTTTTGTAACTGCTGTCTTTACAATAAAGAAAACATCTGCCCTTCTATCTTAACAGCTGTTTACTTTTAAATAAAACATGCAAATGAT

CTTTGCCT
Translation
MSSEELACKLQRRLRLEVRAETDQGDPQPAPCDAPAGHPEPEPPARAPTASADSELNLKLSRRLDIHQGTARPGRSKVFNPYTEFPEFSRRLLKDLEKMF

KT - UNI27021 - TYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDEDFDGKLSFRE - UNI36348 - FLLIFHKAAAGELQEDSGLL

ALAKFSEIDVALEGVRGAKNFFEAK - UNI22832 - - UNI27152 - AQALSCSSKFEAELKAEQEERKREEEARRLRQAAFRELKAAFSA - U

NI22832 - - UNI35348 - 
Transcript ENSMUST00000027472
Sequence
AGAAAGCCACGAGCCCGCAAAGAGCGCACAACTCTCTGTCCCCGTACCGGATCGCGAACCTCAGTTCCATCACCACAACCCGCCATCATGTCCAGCGAGG

AGCTGGCCTGCAAGCTGCAGCGCCGGTTGAGACTTGAGGTGCGGGCAGAGACCGACCAGGGCGACCCCCAGCCTGCACCCTGCGATGCCCCAGCCGGGCA

CCCGGAGCCTGAACCGCCTGCCCGGGCGCCCACAGCCAGCGCGGACTCCGAACTGAACCTCAAGCTGAGCCGCAGGCTGGACATCCACCAGGGTACAGCG

CGGCCGGGCCGCTCTAAGGTCTTCAATCCCTACACCGAGTTCCCGGAGTTCAGCCGCCGCCTCCTGAAGGATCTGGAGAAGATGTTCAAAAC - UNI27

021 - GTATGATGCTGGAAGGGACGGCTTTATTGACCTGATGGAGCTGAAACTCATGATGGAGAAACTGGGGGCCCCTCAGACCCACCTGGGCCTGAAG

AGCATGATCAAGGAGGTGGATGAGGACTTCGACGGGAAGCTCAGCTTCCGGGAG - UNI36348 - TTCCTGCTCATTTTCCACAAGGCTGCTGCTGG

TGAGCTGCAGGAGGACAGTGGGTTGCTGGCACTGGCCAAGTTTTCCGAGATTGATGTCGCCCTGGAAGGTGTCAGAGGTGCCAAGAACTTCTTCGAAGCC

AAG - UNI22832 - - UNI27152 - GCCCAGGCCTTGTCATGTTCCAGTAAGTTCGAAGCTGAGTTAAAAGCTGAGCAAGAAGAGCGGAAACGGG

AGGAGGAGGCCCGGAGGCTCCGCCAGGCAGCCTTCCGGGAGCTCAAGGCAGCTTTCAGCGCGTAGTCCTGCTGACCTGACCTTTGACCGCGGCTGTGCCT

TACTAACACCCTGGAGGTGATGACCAGGATTTTTCACATTTTTATCCCTGCAGCCCTCTGCTCAGATGACCTCCCCTTCACGGCCCAGGCCTGTTTCTTA

GTGCTTCTGGATAACCAGTAACTTGCTTTCGTCCTTCCCAGGGTCCTGGTCCCTTCCAAACGGTTTGCCAGCCAGCCTTTCCAGCCTTCACCCCTCTGCT

GTTATCTGTAGATTCGTTTCTTCTTGGAAACCTTATTTATCCCTGCGGAGTCCTATGTCAACTCCTGTTCATCTACGGTTCTCAGAGGACATGTTGCCTG

TCGGCCCCGGGTAGTTTTTCCTTTGTGTTCCTTGTATTGTTTCCTGGTCAGCGTCTGTCTGCCTTCTTGTTATTACCCAGATTCCATTGACTTCTTTTTC

ACCGTCTTCCACGCTAGTGTGATGATGGGATTTGAAGGAGCACTTGTGGATCAATACCAATATCCCCTCACCAACCAGGGACTAGTTTGATGCTATCTTT

GCCTGTCTCTTGGCTCTTAACAATGCCTACCCTCTTGTTCCCCCTCGTTCATTTCCCAGTCCAGCCATTTTCCCACTCCTAAGTTCTTTACTGTTAAGAA

TGAGAGAATCGTCAGAAGTAATATTAGTGAGTAGAAGGATAGCTGTCACCCGACCCCATTCAAATCAGAGTGGACCTGTGAAACTCTCAAGTGACATCCA

AGGTCTTTTGAAATCATGACCAAATTCCCGTGTCTGACAACAGTTCCAGAGAACTGAAAGAAATGTATTCTCGCCCATGAGACAGATTTTTGTATCTTGA

GTTTCTTGGGACTTCTCACAAATACCTGGGGAGGGGGGTTATGTATTTTTTAACAAAACCAAAACCAAAAATTCTTAATGTCATATTTATTTGACTTGTA

ACTTGTAACTCTTTTGTAACTGCTGTCTTTACAATAAAGAAAACATCTGCCCTTCTATCTTAACAGCTGTTTACTTTTAAATAAAACATGCAAATGATCT

TTGCCTTC
Translation
MSSEELACKLQRRLRLEVRAETDQGDPQPAPCDAPAGHPEPEPPARAPTASADSELNLKLSRRLDIHQGTARPGRSKVFNPYTEFPEFSRRLLKDLEKMF

KT - UNI27021 - TYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDEDFDGKLSFRE - UNI36348 - FLLIFHKAAAGELQEDSGLL

ALAKFSEIDVALEGVRGAKNFFEAK - UNI22832 - - UNI27152 - AQALSCSSKFEAELKAEQEERKREEEARRLRQAAFRELKAAFSA

For any suggestions or comments, please send an email to unitrap@crg.es