Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026305 (Lrrfip1)
Chromosomal location
Chr 1: 92895381 - 93025485 (+)
Description
leucine rich repeat (in FLII) interacting protein 1 Gene [Source:MGI Symbol;Acc:MGI:1342770]
RefSeq_dna
NM_008515 
RefSeq_peptide
NP_001104781.1 NP_032541.1 NP_001104782.1 
UniGene
Mm.45039 Mm.467997 Mm.398050 
MGI
MGI:1342770 
Uniprot/SWISSPROT
Q3UZ39 
Uniprot/SPTREMBL
A6H5U5 Q8BLM1 Q8BLV4 
Human Ortholog
ENSG00000124831 (LRRFIP1)
Omim not available
UniTrap UNI38425
Vector Insertion
Chr 1: 92985289 - 92988178
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI997
Vector Insertion
Chr 1: 93003968 - 93005156
Public Clones AZ0339 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000097649
Sequence
AGGGGATCGTTGAAAGTTCTACTTCTGCCTGGACGGCTTTCCTGGATCCCAGAATGTGGCCTCACTGAGAACCCTCTGCCTGTGGACTAGGGAGCGGGTC

TTCCGCGCGAACTCTTGGGTGGGAAGTTGGTCTGCACTTCACTTCGGCAACATGACCAGCCCAGAGGGCGCGCAAAACAAGGAAATCGACTGTCTGAGTC

CAGAGGCGCAAAGACTG GCGGAGGCCAGGCTCGCAGCGAAGCGTGCAGCCCGAGCCGAGGCTCGAGAGATCCGGATGAAGGAGCTGGAACGGCAGCAGA

AAGAG GTAGAAGAAAGACCAGACAAAGACTTTGCTGAGAAG GGCTCCCGTAACATGCCTAGCCTGTCTGCAGCCACACTGGCATCTCTGGGTGGGACT

TCCTCCCGGAGAGGGAGTGGAGATACCTCCATCTCCATGGACACCGAAGCATCCATCAGGGAAATCAAG GACTCGCTGGCCGAAGTTGAGGAGAAGTAC

AAGAAAGCTATGGTCTCCAACGCCCAGCTAGACAATGAGAAGACCAACTTCATGTACCAGGTGGACACACTGAAGGACATGCTGCTGGAGCTGGAAGAGC

AGCTGGCCGAGTCTCAGCGGCAATACGAGGAGAAGAACAAG GAGTTCGAGAGGGAGAAGCATGCCCACAGCATCCTGCAGTTCCAGTTTGCCGAAGTGA

AAGAGGCCCTGCGGCAAAGGGAAGAGATGCTCGAG - UNI997 - AAACATGGAATAATCCTAAATTCAGAAATAGCCACCAACGGAGAGACTTCAGA

CACAGTAAATGACGTTGGGTATCAAGCCCCTACGAAGATAACAAAAGAAGAGCTGAATGCCCTCAAGTCGGCCGGGGAGGGGACCCTAG GAAAAGCCAA

AGAAGTGGAGGTGAAAAAGGAAATTGTGGAGAAAGTGGGGCAAAGAGAAACCTTACAGAATTCTGAGCAAGAACAGCCCAAACCCAACACAGGAAAGGAT

TGTGTGGACAGAGGGGTGTCACATCCTGGTGAGAAGGCTGAGAACCAGAGACCCGCTGAAGACAGTGCCCTGTCCCCGGGACCACTAGCAGGGGCCAAAT

GTGAGCAACAGGTTCAGAGCCAAGATCAAGAGAATACTTCTGACCTCAAAAACTCAGAGCAGATCGAGTCACACAAGGTCACAAACAAGTCAGATAGTAG

GGCCAGTAACTCCCCTGAACAGTCCAGCTGCCTGGAAGGTCTAGACAGTGAAGTGCCAGGGCCCACTGAGGATTTGAAAACAGATTTGGGGAAAGGTAGC

TTTGAACCATGTCCAGACTACATTTTGGGGCAAACAGCTGAAATTGACAAGGTGACCTGTACAGACTCAAGAGGCACAGGTGGAAACCAAAGGGAGGATG

AGGTACAGGCAGGGGACACCACAGTTGAGGACCAAGTAGGGACAGTGGCTTCTGGACCTGCAAAGCAAAGCAAAGGCACCGAGAATCATGGTGAAAGTTG

TCTGAAGGATGGGCTGGGACAGAGCTCAGAGAGAGAACTCACCCAAGAAGTAGCTGAGCCTGAGGAAGCCATCGTTCAGATCCCACAGGCCGGTGGAGAG

AACACTATTACCAAGGCAGATGATGCCGAAGGAAGGGATGAGAAGCCCATCCAGGCAGAAGCCCAGGCAAGCCCTGGAGCTCCCATAAATCAGAGCGGCC

ATCAGGACACAACAGGACCAGGCAGCACCGATGCCCAGCGCACACCACCTCATGCAAAAGAGCGCAAGAAACAAGGGAAGAGCGAGCAGCAGGCAGAGGC

CTTGGATTCACCGCAGAAGAAGACGAAGAACAAGAAGAAGAAGAACAAGAAGAAGAAAGCTGCAACTCCCGCGGAAACCTGCAGAGATGCCAATGAAGAG

TTGAACTGTCAGGACCCAGATGTGGGTGACATGGAGGAGGAAGAGCGGCTCCAGGTCACTGACAAGAAACAGGCATCAGGAAGCCCAGAGCAGAAAATCA

GAGCGGGAAGCAGAGAACCTGTCGAAGATCCTCAAAGTGGGTCGAGTGGAAAACAGAACAAAGTGGAAGAGGATGGTCCCACGGAAGGTCCCACAGACAT

CTTGGATCAGAACAGTCCCCAGTGTGAAGACAGGGAGATCTCCCCAGTGGGAGAGAAAGGTCCCCAATGCGATACCTCTCAGATAGGTAGTGAAGAGGGA

CATGTGACCTCCCAACACGGTGGTCAGGCAGTTGAGAACCACAACCTAGATAACAGTGACCTGTCAGGGCAGCTGGAGGGCTTCAATTCAGAAAGTGGAG

GGCAGGCAAGAGAGGAGGTTGGGAATAGCAAGAGTAAGGAGGACTGCACCATGTCGTGA
Translation
MTSPEGAQNKEIDCLSPEAQRL AEARLAAKRAARAEAREIRMKELERQQKE VEERPDKDFAEK GSRNMPSLSAATLASLGGTSSRRGSGDTSISMDT

EASIREIK DSLAEVEEKYKKAMVSNAQLDNEKTNFMYQVDTLKDMLLELEEQLAESQRQYEEKNK EFEREKHAHSILQFQFAEVKEALRQREEMLE -

 UNI997 - KHGIILNSEIATNGETSDTVNDVGYQAPTKITKEELNALKSAGEGTLG GKAKEVEVKKEIVEKVGQRETLQNSEQEQPKPNTGKDCVDR

GVSHPGEKAENQRPAEDSALSPGPLAGAKCEQQVQSQDQENTSDLKNSEQIESHKVTNKSDSRASNSPEQSSCLEGLDSEVPGPTEDLKTDLGKGSFEPC

PDYILGQTAEIDKVTCTDSRGTGGNQREDEVQAGDTTVEDQVGTVASGPAKQSKGTENHGESCLKDGLGQSSERELTQEVAEPEEAIVQIPQAGGENTIT

KADDAEGRDEKPIQAEAQASPGAPINQSGHQDTTGPGSTDAQRTPPHAKERKKQGKSEQQAEALDSPQKKTKNKKKKNKKKKAATPAETCRDANEELNCQ

DPDVGDMEEEERLQVTDKKQASGSPEQKIRAGSREPVEDPQSGSSGKQNKVEEDGPTEGPTDILDQNSPQCEDREISPVGEKGPQCDTSQIGSEEGHVTS

QHGGQAVENHNLDNSDLSGQLEGFNSESGGQAREEVGNSKSKEDCTMS
Transcript ENSMUST00000097650
Sequence
AGGGGATCGTTGAAAGTTCTACTTCTGCCTGGACGGCTTTCCTGGATCCCAGAATGTGGCCTCACTGAGAACCCTCTGCCTGTGGACTAGGGAGCGGGTC

TTCCGCGCGAACTCTTGGGTGGGAAGTTGGTCTGCACTTCACTTCGGCAACATGACCAGCCCAGAGGGCGCGCAAAACAAGGAAATCGACTGTCTGAGTC

CAGAGGCGCAAAGACTG GCGGAGGCCAGGCTCGCAGCGAAGCGTGCAGCCCGAGCCGAGGCTCGAGAGATCCGGATGAAGGAGCTGGAACGGCAGCAGA

AAGAG ATCTATCAAGTCCAGAAG AAATATTATGGGCTGGATACAAAATGGGGCGACATCGAGCAGTGGATG GAAGACAGCGAGCGCTACTCTCGTAG

ATTCCGGAGAAACACGTCG GCTTCTGACGAAGACGAGCGCTTGTCCGTGGGTAGTCGCGGCAGCCTAAGG ACTAACGGTTATGACGGAGACTATTGTG

GATCCCAGTCCCTAAGTAGAAGATCTGGCAGG GGACTCTCCTGCTCCAACCTTGGCCTTCCCAGCAGTGGCCTTGCTTCCAAACCCCTGTCTACCCAGA

ATGGATCCCGG GCGTCCATGCTGGATGAGAGCAGCCTCTATGGGGCTCGAAGGGGAAGCGCCTGTGGTTCTCGAGCA CCCTCAGAATATGGCAGCCAC

CTCAACTCCAGCTCCCGGGCCTCTTCTAGGGCCAGCTCTGCAAGGGCCAGTCCTGTG GTAGAAGAAAGACCAGACAAAGACTTTGCTGAGAAG GGCTC

CCGTAACATGCCTAGCCTGTCTGCAGCCACACTGGCATCTCTGGGTGGGACTTCCTCCCGGAGAGGGAGTGGAGATACCTCCATCTCCATGGACACCGAA

GCATCCATCAGGGAAATCAAG GAACTTAATGAGTTAAAGGACCAGATTCAGGATGTAGAAGGCAAATACATGCAGGGACTGAAAGAGATGAAG GACTC

GCTGGCCGAAGTTGAGGAGAAGTACAAGAAAGCTATGGTCTCCAACGCCCAGCTAGACAATGAGAAGACCAACTTCATGTACCAGGTGGACACACTGAAG

GACATGCTGCTGGAGCTGGAAGAGCAGCTGGCCGAGTCTCAGCGGCAATACGAGGAGAAGAACAAG GAGTTCGAGAGGGAGAAGCATGCCCACAGCATC

CTGCAGTTCCAGTTTGCCGAAGTGAAAGAGGCCCTGCGGCAAAGGGAAGAGATGCTCGAG - UNI997 - GAAATCCGACAGCTGCAGCAGAAACAGG

CGGGTTTTATCAGGGAGATTTCTGATCTTCAGGAAACGATAGAATGGAAAGACAAAAAGATAGGG GCATTAGAAAGACAGAAAGAGTTCTTTGATTCCA

TAAGGAGCGAACGAGATGACCTTAGAGAAGAAACAGTCAAGCTGAAGGAGGAGTTGAAG AAACATGGAATAATCCTAAATTCAGAAATAGCCACCAACG

GAGAGACTTCAGACACAGTAAATGACGTTGGGTATCAAGCCCCTACGAAGATAACAAAAGAAGAGCTGAATGCCCTCAAGTCGGCCGGGGAGGGGACCCT

AG ACGTTAGGTTGAAAAAGCTCATTGATGAACGGGAATGTCTGTTGGAACAG ATTAAGAAGCTCAAAGGGCAGCTGGAGGGAAGACAGAAGAACAACA

AGCTGGACCTTCTTCGAGCCGAGGACGGTATCTTGGAGAATGGGACAGACGCGCATGTCATGGATCTGCAAA GAGATGCCAACAGACAGATCAGCGACC

TCAAATTTAAACTTGCAAAATCTGAGCAAGAGATAACTGCCTTAGAACAAAAT GTAATAAGGTTAGAGAGCCAAGTAACGCGCTATCGATCAGCCGCCG

AAAATGCAGAAAAAATAGAAGATGAACTAAAGGCAGAAAAACGGAAGCTCCAGAGAGAG CTTCGCTCTGCACTGGACAAAACAGAAGAGCTCGAGGTGA

GCAACGGCCACCTCGTAAAGCGACTGGAAAAGATGAAAGCCAACCGCAGCGCTCTCTTGTCCCAGCAATAAATACCAGCAGCAAGTGGGCACCTCTCTGG

GGACTCAGATGCCCAGCCTGGCTTATGAGCTTTTATCTGTACTGTCGGGAGCATTGCATCTTTCCCTGCCTCCGAGGGAAGAAGTGCTTCCATGCAAGGG

TCACCCGGGGAGCCCAGCAGCACCAGATGCCTCTGTCTGCAGACCCTTGCCCTGGCCGGGATGATACTCAGAGCCTGCAGGTTTCTTCATAAGCACACTG

GGTCTCACGAGAGCTCTGGACTTGATGCACAGGGGCCTCTTAATCCCACCAACAGGGGTGACTGAGGTGGGGGTTAAGGTGGGACTTGATTTTTCTTTTG

TGTCTTGCTGAAGGTTAAGGGAGAATGTTCCAGTGTTGGGGACGATCCGTGGTGGAACCTACAGTCCCAATGACTCCAGTAGTGTCTCTTAGTCTCTGCT

TCCCATACACAAAACACTGTGGAACCACAAGCCATTACCAAGCAAAGCTCCTCCTTTGGAGTCGAGGCGATGGTCTAGACGTAAAGTGACCTTAAGAAGA

CTCTTTCCAGGCAACAGATGAAGCTTTTCTAAGGGACTTTTGCATTGGTTCAGTTATAAGAGTACTTTTCCCAGGGTCATTAGGCTACGGTAGCTTCACC

GAAAACAACAGCTTTTCATTTGCATTATTTAAACCTTATATTTGAAATTGAAGTTGTTAACTTCTTTTAAAGAATGTACTGCT
Translation
MTSPEGAQNKEIDCLSPEAQRL AEARLAAKRAARAEAREIRMKELERQQKE IYQVQK KYYGLDTKWGDIEQWM EDSERYSRRFRRNTS ASDEDER

LSVGSRGSLR TNGYDGDYCGSQSLSRRSGR GLSCSNLGLPSSGLASKPLSTQNGSR ASMLDESSLYGARRGSACGSRA PSEYGSHLNSSSRASSRA

SSARASPV VEERPDKDFAEK GSRNMPSLSAATLASLGGTSSRRGSGDTSISMDTEASIREIK ELNELKDQIQDVEGKYMQGLKEMK DSLAEVEEKY

KKAMVSNAQLDNEKTNFMYQVDTLKDMLLELEEQLAESQRQYEEKNK EFEREKHAHSILQFQFAEVKEALRQREEMLE - UNI997 - EIRQLQQKQ

AGFIREISDLQETIEWKDKKIG ALERQKEFFDSIRSERDDLREETVKLKEELK KHGIILNSEIATNGETSDTVNDVGYQAPTKITKEELNALKSAGEG

TLD DVRLKKLIDERECLLEQ IKKLKGQLEGRQKNNKLDLLRAEDGILENGTDAHVMDLQR RDANRQISDLKFKLAKSEQEITALEQN VIRLESQVT

RYRSAAENAEKIEDELKAEKRKLQRE LRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQ
Transcript ENSMUST00000068167
Sequence
ATGGGCACGCAGGGATCGGGGCGCAAGCGGCTCCCCAACCGGGAGCGGCTGACGGCGGAGGACGACGCGCTGAACCAGATCGCGCGCGAG GCGGAGGCC

AGGCTCGCAGCGAAGCGTGCAGCCCGAGCCGAGGCTCGAGAGATCCGGATGAAGGAGCTGGAACGGCAGCAGAAAGAG ATCTATCAAGTCCAGAAG AA

ATATTATGGGCTGGATACAAAATGGGGCGACATCGAGCAGTGGATG GAAGACAGCGAGCGCTACTCTCGTAGATTCCGGAGAAACACGTCG GCTTCTG

ACGAAGACGAGCGCTTGTCCGTGGGTAGTCGCGGCAGCCTAAGG ACTAACGGTTATGACGGAGACTATTGTGGATCCCAGTCCCTAAGTAGAAGATCTG

GCAGG CCCTCAGAATATGGCAGCCACCTCAACTCCAGCTCCCGGGCCTCTTCTAGGGCCAGCTCTGCAAGGGCCAGTCCTGTG GTAGAAGAAAGACCA

GACAAAGACTTTGCTGAGAAG GGCTCCCGTAACATGCCTAGCCTGTCTGCAGCCACACTGGCATCTCTGGGTGGGACTTCCTCCCGGAGAGGGAGTGGA

GATACCTCCATCTCCATGGACACCGAAGCATCCATCAGGGAAATCAAG GACTCGCTGGCCGAAGTTGAGGAGAAGTACAAGAAAGCTATGGTCTCCAAC

GCCCAGCTAGACAATGAGAAGACCAACTTCATGTACCAGGTGGACACACTGAAGGACATGCTGCTGGAGCTGGAAGAGCAGCTGGCCGAGTCTCAGCGGC

AATACGAGGAGAAGAACAAG GAGTTCGAGAGGGAGAAGCATGCCCACAGCATCCTGCAGTTCCAGTTTGCCGAAGTGAAAGAGGCCCTGCGGCAAAGGG

AAGAGATGCTCGAG - UNI997 - GAAATCCGACAGCTGCAGCAGAAACAGGCGGGTTTTATCAGGGAGATTTCTGATCTTCAGGAAACGATAGAATG

GAAAGACAAAAAGATAGGG GCATTAGAAAGACAGAAAGAGTTCTTTGATTCCATAAGGAGCGAACGAGATGACCTTAGAGAAGAAACAGTCAAGCTGAA

GGAGGAGTTGAAG AAACATGGAATAATCCTAAATTCAGAAATAGCCACCAACGGAGAGACTTCAGACACAGTAAATGACGTTGGGTATCAAGCCCCTAC

GAAGATAACAAAAGAAGAGCTGAATGCCCTCAAGTCGGCCGGGGAGGGGACCCTAG ACGTTAGGTTGAAAAAGCTCATTGATGAACGGGAATGTCTGTT

GGAACAG ATTAAGAAGCTCAAAGGGCAGCTGGAGGGAAGACAGAAGAACAACAAGCTGGACCTTCTTCGAGCCGAGGACGGTATCTTGGAGAATGGGAC

AGACGCGCATGTCATGGATCTGCAAA GAGATGCCAACAGACAGATCAGCGACCTCAAATTTAAACTTGCAAAATCTGAGCAAGAGATAACTGCCTTAGA

ACAAAAT GTAATAAGGTTAGAGAGCCAAGTAACGCGCTATCGATCAGCCGCCGAAAATGCAGAAAAAATAGAAGATGAACTAAAGGCAGAAAAACGGAA

GCTCCAGAGAGAG CTTCGCTCTGCACTGGACAAAACAGAAGAGCTCGAGGTGAGCAACGGCCACCTCGTAAAGCGACTGGAAAAGATGAAAGCCAACCG

CAGCGCTCTCTTGTCCCAGCAATAAATACCAGCAGCAAGTGGGCACCTCTCTGGGGACTCAGATGCCCAGCCTGGCTTATGAGCTTTTATCTGTACTGTC

GGGAGCATTGCATCTTTCCCTGCCTCCGAGGGAAGAAGTGCTTCCATGCAAGGGTCACCCGGGGAGCCCAGCAGCACCAGATGCCTCTGTCTGCAGACCC

TTGCCCTGGCCGGGATGATACTCAGAGCCTGCAGGTTTCTTCATAAGCACACTGGGTCTCACGAGAGCTCTGGACTTGATGCACAGGGGCCTCTTAATCC

CACCAACAGGGGTGACTGAGGTGGGGGTTAAGGTGGGACTTGATTTTTCTTTTGTGTCTTGCTGAAGGTTAAGGGAGAATGTTCCAGTGTTGGGGACGAT

CCGTGGTGGAACCTACAGTCCCAATGACTCCAGTAGTGTCTCTTAGTCTCTGCTTCCCATACACAAAACACTGTGGAACCACAAGCCATTACCAAGCAAA

GCTCCTCCTTTGGAGTCGAGGCGATGGTCTAGACGTAAAGTGACCTTAAGAAGACTCTTTCCAGGCAACAGATGAAGCTTTTCTAAGGGACTTTTGCATT

GGTTCAGTTATAAGAGTACTTTTCCCAGGGTCATTAGGCTACGGTAGCTTCACCGAAAACAACAGCTTTTCATTTGCATTATTTAAACCTTATATTTGAA

ATTGAAGTTGTTAACTTCTTTTAAAGAATGTACTGCT
Translation
MGTQGSGRKRLPNRERLTAEDDALNQIARE AEARLAAKRAARAEAREIRMKELERQQKE IYQVQK KYYGLDTKWGDIEQWM EDSERYSRRFRRNTS

 ASDEDERLSVGSRGSLR TNGYDGDYCGSQSLSRRSGR PSEYGSHLNSSSRASSRASSARASPV VEERPDKDFAEK GSRNMPSLSAATLASLGGTS

SRRGSGDTSISMDTEASIREIK DSLAEVEEKYKKAMVSNAQLDNEKTNFMYQVDTLKDMLLELEEQLAESQRQYEEKNK EFEREKHAHSILQFQFAEV

KEALRQREEMLE - UNI997 - EIRQLQQKQAGFIREISDLQ       
Transcript ENSMUST00000068116
Sequence
ATGGGCACGCAGGGATCGGGGCGCAAGCGGCTCCCCAACCGGGAGCGGCTGACGGCGGAGGACGACGCGCTGAACCAGATCGCGCGCGAG GCGGAGGCC

AGGCTCGCAGCGAAGCGTGCAGCCCGAGCCGAGGCTCGAGAGATCCGGATGAAGGAGCTGGAACGGCAGCAGAAAGAG GTAGAAGAAAGACCAGACAAA

GACTTTGCTGAGAAG GGCTCCCGTAACATGCCTAGCCTGTCTGCAGCCACACTGGCATCTCTGGGTGGGACTTCCTCCCGGAGAGGGAGTGGAGATACC

TCCATCTCCATGGACACCGAAGCATCCATCAGGGAAATCAAG GAACTTAATGAGTTAAAGGACCAGATTCAGGATGTAGAAGGCAAATACATGCAGGGA

CTGAAAGAGATGAAG GACTCGCTGGCCGAAGTTGAGGAGAAGTACAAGAAAGCTATGGTCTCCAACGCCCAGCTAGACAATGAGAAGACCAACTTCATG

TACCAGGTGGACACACTGAAGGACATGCTGCTGGAGCTGGAAGAGCAGCTGGCCGAGTCTCAGCGGCAATACGAGGAGAAGAACAAG GAGTTCGAGAGG

GAGAAGCATGCCCACAGCATCCTGCAGTTCCAGTTTGCCGAAGTGAAAGAGGCCCTGCGGCAAAGGGAAGAGATGCTCGAG - UNI997 - AAACATG

GAATAATCCTAAATTCAGAAATAGCCACCAACGGAGAGACTTCAGACACAGTAAATGACGTTGGGTATCAAGCCCCTACGAAGATAACAAAAGAAGAGCT

GAATGCCCTCAAGTCGGCCGGGGAGGGGACCCTAG ACGTTAGGTTGAAAAAGCTCATTGATGAACGGGAATGTCTGTTGGAACAG ATTAAGAAGCTCA

AAGGGCAGCTGGAGGGAAGACAGAAGAACAACAAGCTGGACCTTCTTCGAGCCGAGGACGGTATCTTGGAGAATGGGACAGACGCGCATGTCATGGATCT

GCAAA GAGATGCCAACAGACAGATCAGCGACCTCAAATTTAAACTTGCAAAATCTGAGCAAGAGATAACTGCCTTAGAACAAAAT GTAATAAGGTTAG

AGAGCCAAGTAACGCGCTATCGATCAGCCGCCGAAAATGCAGAAAAAATAGAAGATGAACTAAAGGCAGAAAAACGGAAGCTCCAGAGAGAG CTTCGCT

CTGCACTGGACAAAACAGAAGAGCTCGAGGTGAGCAACGGCCACCTCGTAAAGCGACTGGAAAAGATGAAAGCCAACCGCAGCGCTCTCTTGTCCCAGCA

ATAAATACCAGCAGCAAGTGGGCACCTCTCTGGGGACTCAGATGCCCAGCCTGGCTTATGAGCTTTTATCTGTACTGTCGGGAGCATTGCATCTTTCCCT

GCCTCCGAGGGAAGAAGTGCTTCCATGCAAGGGTCACCCGGGGAGCCCAGCAGCACCAGATGCCTCTGTCTGCAGACCCTTGCCCTGGCCGGGATGATAC

TCAGAGCCTGCAGGTTTCTTCATAAGCACACTGGGTCTCACGAGAGCTCTGGACTTGATGCACAGGGGCCTCTTAATCCCACCAACAGGGGTGACTGAGG

TGGGGGTTAAGGTGGGACTTGATTTTTCTTTTGTGTCTTGCTGAAGGTTAAGGGAGAATGTTCCAGTGTTGGGGACGATCCGTGGTGGAACCTACAGTCC

CAATGACTCCAGTAGTGTCTCTTAGTCTCTGCTTCCCATACACAAAACACTGTGGAACCACAAGCCATTACCAAGCAAAGCTCCTCCTTTGGAGTCGAGG

CGATGGTCTAGACGTAAAGTGACCTTAAGAAGACTCTTTCCAGGCAACAGATGAAGCTTTTCTAAGGGACTTTTGCATTGGTTCAGTTATAAGAGTACTT

TTCCCAGGGTCATTAGGCTACGGTAGCTTCACCGAAAACAACAGCTTTTCATTTGCATTATTTAAACCTTATATTTGAAATTGAAGTTGTTAACTTCTTT

TAAAGAATGTACTGCT
Translation
MGTQGSGRKRLPNRERLTAEDDALNQIARE AEARLAAKRAARAEAREIRMKELERQQKE VEERPDKDFAEK GSRNMPSLSAATLASLGGTSSRRGSG

DTSISMDTEASIREIK ELNELKDQIQDVEGKYMQGLKEMK DSLAEVEEKYKKAMVSNAQLDNEKTNFMYQVDTLKDMLLELEEQLAESQRQYEEKNK 

EFEREKHAHSILQFQFAEVKEALRQREEMLE - UNI997 - KHGIILNSEIATNGETSDTVNDVGYQAPTKITKEELNALKSAGEGTLD DVRLKKLI

DERECLLEQ IKKLKGQLEGRQKNNKLDLLRAEDGILENGTDAHVMDLQR RDANRQISDLKFKLAKSEQEITALEQN VIRLESQVTRYRSAAENAEKI

EDELKAEKRKLQRE LRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQ

For any suggestions or comments, please send an email to unitrap@crg.es