Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026311 (AC109199.10)
Chromosomal location
Chr 1: 93437121 - 93456167 (+)
Description
Ankyrin repeat and SOCS box protein 1 (ASB-1) [Source:UniProtKB/Swiss-Prot;Acc:Q9WV74]
RefSeq_dna
NM_023046 NM_001039126 
RefSeq_peptide
NP_075533.3 NP_001034215.1 
UniGene
Mm.408952 Mm.409514 Mm.234152 
Uniprot/SWISSPROT
Q9WV74 
Uniprot/SPTREMBL
Q810P1 Q9D9S9 Q3U5A0 Q80TI9 Q05BP3 
Human Ortholog
not available
Omim not available
UniTrap UNI34912
Vector Insertion
Chr 1: 93440875 - 93443504
Public Clones IST11069H12 (tigm) IST14894D3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000086843
Sequence
CTTTCTGGTGGAGCTAGCCTTGTAACTGCCACCCTGTTAGCCCATCCCCGTCAGCGATGACCCTGGCTGGACCATGGGGTTCGGATCTTCTTCCAG TGC

AGGTCCTAATCTGAAGGAGTGGCTGAGGGAGCAGTTCTGTGACCATCCACTGGAGCACTGTGACGATACAAGACTCCATGATGCAGCCTATGTAGGGGAC

CTCCAGACCCTCAGGAACCTACTGCAAGAGGAGAGCTACCGGAG - UNI34912 - CCGCATCAATGAGAAGTCTGTCTGGTGCTGCGGCTGGCTTCC

CTGCACACCACTGAGGATCGCAGCCACTGCAGGCCATGGGAACTGTGTGGACTTCCTCATACGCAAAGGGGCCGAGGTGGACCTGGTGGATGTCAAGGGG

CAGACTGCCCTGTATGTGGCTGTAGTGAACGGGCACTTGGAGAGCACTGAGATCCTTTTGGAAGCTGGTGCTGATCCCAACGGCAGCCGGCACCACCGCA

GCACTCCTGTGTACCATGCCTCTCGTGTGGGTAGGGACGACATCCTGAAGGCTCTTATCAG GTATGGGGCAGATGTTGATGTCAACCATCATCTGACTC

CTGACACCCGGCCCCCTTTTTCACGGCGGCTAACCTCCTTGGTGGTCTGTCCTCTATACATCAGTGCTGCCTACCATAACCTTCAGTGCTTCAGGCTGCT

CTTGCAGGCTGGGGCAAATCCTGACTTCAATTGCAATGGCCCTGTCAACACCCAGGAGTTCTACAGGGGATCCCCTGGGTGTGTCATGGATGCTGTCCTG

CGCCATGGCTGTGAAGCAGCCTTCGTGAGTCTGTTGGTAGAGTTTGGAGCCAACCTGAACCTGGTGAAGTGGGAATCCCTGGGCCCAGAGGCAAGAGGCA

GAAGAAAGATGGATCCTGAGGCCTTGCAGGTCTTTAAAGAGGCCAGAA GTATTCCCAGGACCTTGCTGAGTTTGTGCCGGGTGGCTGTGAGAAGAGCTC

TTGGCAAATACCGACTGCATCTGGTTCCCTCGCTGCCGCTGCCAGACCCCATAAAGAAGTTTTTGCTTTATGAGTAGCATTCACATGCAGTGCTGACTGC

AATGTGGAAGCCGATCACCTGCAGTGAAAACTGACACAGACTCTGGCATCCTGGGAACCATGGCCTGTGCTGCCAGCTTGATCCTTGGCTGTCAGTGAAG

AAGAAACGGCTGTGTTCTCTTGGACTGTGATTCTATCTCAGGTGCTTGGGCCATCGAACGCTCCTTGAGTCATTGTCAACTGAGAGGCACATACAAACTT

AATTTTGTTCCTCTTCAGTCTCTCTGTTTTGGATTCTTCCTGGCAATGTGTGCAGCATGGGCTGAGCCTGGTGATTGCCCTAGTGGGGAAGGCTTTTTTC

TCCAGGCTATGCATCTATTTATGTTCCTACTTTGCAATTTATTGTTCTTTTAAGGCTTGATATCAAAACAGAAAGAGGTTTGTTAAGAAAAGATATAGGG

AGAAGGAATTCGGTTCGTGCACTTGCTAGCCTGCTTTCTTGCCTGGGTTTGTCTGTCTATGCTGCCTGGTGCACATCCCTTCTCTTTGCTGCCACTGTTC

TATTTTGGGAGTTGTCTTCCGTCTAAGATGGCTTCTGGGGTTCTATCTTATTGCACAGAGGTCCCAGAACAGTGTTCATAGGGCACCATCTGCTCTGCCA

AGGGTTTTCTGATGTCTTACCCTGGGGATCTTCAGACAGTGGTTACCTTTAGGAGACCCACCTGGAACTAACCATTAAGTGACTGCCCACATTCAGATCA

GGGACCATCTTAATAGTACTCACTGCCAGTCCTCACAAGAGAAGATGACACGGGTGCTCTCTTCAGACACTCCCATACAGGAAGTGGAAAATGTCTTGGT

CACCTGGGTGGTTCCAGGCTACAACTTCTTGGTGTCCACTAGACAGGATATCTAGGTGTTGGGTGACTGTTCCTCCCACTTTCTGACCCAATGCCTTTGT

GGGTGCTTCTAGAGGTCTTTCCCTGTCCTGCCCAGGGCTGTTGGTGGGTGAGAGAGATGAGCTTATTGCAGGATTGCAGGTTTGTTTAACTCTTGAGTGG

TGAGTGTCACAGCAGGTGGGCCCATAACCACGGCCTTGAGCATCCTTAGGTTGCTCCTGTTTCAGTGAAGTCACCTTTTGTCATTCTGAAGCCTGTTAGG

ATTACTGTGTGGACCTTGCTGATTATAGACTTGAGAATATTTGGGACAAGCAGGTAATAAATCTGTTTAGACTTTTGGCCATAAAGGGGATTTAACTTGT

TAATACTTTCCTAGTGTACCATTTTGTGTTTTAGCTGACCAGTCAGGCAGTTGGTAGCCTTGGGATTCTGTGGATGGAGTTCCAAACCCCACCCCAGTGC

CTCAGGAAGGCCCAAGGCAGCAACACCAAGCTGGTCCAAATGTACTACATGAGTTTTGATGAGCCTTGCCCAGTCCTGGACAGTGAGTCCTGTGTCTGGG

GCAGGAATGAGCTGGCCAGAGCCTGTCCCTGTCTCCCCACAGCTGTTCTGTGTGGCCCCAGCACAGCTCTTCACTTGGACTTGAGTAGCTTTCCCTGTCT

CAAACCAGTTTTCAGAACCTTTCAATCACTTCAAGGTTCTGCATGTTCAGAATTTCCAGCCGGTAACTCTGAATGTGACACAGCATCGGCATGGACTGAG

GGCACTTCCCCTTGTCGCCAGTATGCTATGAAGGCACTGCATGTCATTGCTGTCAAGGATGAGGTACGGGGTAAGAAGCACCCCAGGTTCATGAGAGGTA

CCATAGGAAGTTGATGTGACTTCGGTGAGGACTGACCCTCTACTCAGCAGACTTCTGAGCTCTGGTTACCTGTGTCCTTCCTAGCATGGGGATGTGGGTG

TCTGATGAACCTACTGCCTTCTGGCTGAACTGGCCCTAGCAGAAGAGCTTAGTGGTCCAGAGGAAGGAGCCTGAGGGTTGTCCCAGCTCATCAAAGGGGT

ATTTGTGGGGTTGTTGCTGTTACTGGGGCAGCCACTTGATTTAAGTGAAGACTTGTGTAGTGGAATCTTGGCTAGGCAGGTTGGAACCAGTGATGATCCC

TCAGAATTTATCTTTTCAGTATTGGGCTTTTAGACATATGTCCAGAAACCTGCCAAGGCAATGCCATACATTTTGTAGCTATTTTACTTGTGATGTCTAT

CTGTCTGTCTGTCTGTCTGTCTATCTATCTATCTATTAATCTATTATCTACTTATCATCTATGTATTTATGTATTTATTTGTTTATATATTTTTGTATTT

ATTTATTTATTCATATTCTTTTTCCATAAGAGGACTTAAGCTGGAGAGTCTTATTTTGTTTTGACAGTAGATTGGTAAAGTAGATAATTGGCATTTTTCA

AATATTGACCAGTACTGATGTCAGGCTTAAGGACCATTATTTCAGAGTTTCCCCTTTTCACTTTCATGAATGAATTTTTAGATAAAAATTTCCTGAAAGA

TAAAGTCCTGACTGTGGGCCAGAGCGGAGGGAAGTTCTTCATGCCTGAGAGCTGCTCTGGCCTGTGCTCAGCCAGTTCCTGGAGCAGTGTCTGCTCTGCA

GCAGACAGGAAGAGCTCTTCCTGTGCCTTTCCAGGGACCCTGCTGAGGTCCTGTGAAGTGCCGAGGCTGCAGACACTTTGTTTGGGAGGGGTCTCTGTCC

TGAGAAAACTGCTTCCTAGTGGAAGTGCACTTACGGTGGTCACAGTGCTGAGAGCCCACAGTCTGGATTTGGGATTGACCTTGTGGGGCGGTTGGATCAT

CTTGACCCACAGTGCAGCACCAACAGAGAGCCATTCGAGCAAAAGGGTAAGGGTGGCTTGTAGTACTTGAGGAAATCAAATTTCCTCAGCTGACTGGACT

GCCTTTTATTCTTCAGTCATGTCATTCCTGACAACAGAAGGCTTGCTGGAAAGGGATGGTATGGGGCTATGGCTTTGCATGTAAAACACTTTTGATTGGG

ATCCACAGCAGTGTTCTTTTCACCTCTGCCTGCTGCTGTCCTGGCACAGTCTGATTGTAGTGGATGCTACATATTAATGAGGAAGTTTTAGATCCTAAGT

AGCATTCCTGGTGGTGAAAGGCATTGTGGCTTTCCCATGGCCTGGGGTCTAAGTGTAAGCTGGAGGACCACTGTGCGCGACCTGAGGAGTCTAGACATGC

TTTTGAAGCGCCTCTACCACCCCAGATCCATGAGGTCACCACAGAAAGTGTGGCCTTTTTGGTAAGACTTGCTTGTCCTTCACTCAGGCCTTGGGAACCA

GTGGCACCTAGGATGCTGGTGATGATGTCACCAGTGGTGGTCTGCTGGTACCTGTGTCTCCTTGGTGCCTGCACACCGGGCACTTGGAGACTAATCCTGC

CCTGCAGGGATCAGATGACTTTCCATCCGCACAGAGATTCCTGGAAGTGCCTCTTGACTTGGGAGCTTCTTTCTTTCCCTTGCTCATTTTCACCTCGTTG

CTCTCCTTCCCAGAGTTCCTTGGTGTGCAATAAAGTAGTAGGTATAACTGGTTAGGGACTCTTAGTCATCTCAGGAAAGTCCCACAGATGGGTACATGCA

AGCTTTGAAGTGGGCAGTGATCTGTGGAATTTACTATACACTCCAGCCTGACATAGGACAATGGAGTGAGGAGAATGCGGGGAACTGCCGTAGCCTTAAC

AGACACCCAATACCCAGTGTCAATGATGCATGGGGATCCAACCAGATCCTGTGCATGTAAGACAAGCACTCGACCACTGAGCTGTATCTTCTGCCTCTTT

ATGTCTTAGGTAAATGAAGCAATGGAAGGGTTTTTGTAAATCTCACTTGAGATTGCCATTTATGAACCTAATTGTCTTGGACATGCAATGTCAGTGCCCT

GTTCTCTCCTGCAGTGTCTGCATGGCGTCCACTACTTCTGTTGGTGTTGGGCGTGTGTAGTGTCCCGTGCACTGGGGCCTGTGTGCTTGTGCTGAAGTCG

TGCTCACTGCAGCCCTCTAGTTCCTGTTTGAGGATGAATGAGTGCTTGTTTGCAGTGCCCTGGACTGACTTGCTTTTGCCCTTGTGCCTAGTTAAGAGAT

TTCAAAAGGTCAATGACTTTTTTTATACATTGTTATAATAAATGCTTTATTGCCCTCTGATTTCCTTCCCACATGCCTTAATTTTGTGGCCCGTGTCTCA

CTGAATAGAAGCTTCCTCTGTGTACAGTCTCTTATTTACATTAGTTCATCATTCATTCATTCATTCATTCATTCATTCATTCATGTGTGATGTGTGTGTC

ATCTTGTATCTGCGCTCACATATAAGCTATGGTGTGGATGTGGAGATCAAAGGACAGTGTTTGGGAGTTGGTTCTCCCAAGAGCCGAGCCTCTTATAGCC

TCCCCGTGCAGCTGTGTGCACAGTTCAAGTGGGAGGGGCTGGCTCCTGGATAGCTTCCTATGGCTGGAGAGAAGGTTCTAAAGCAGGAGTCTGTAGCTGT

TCAGTGGATCTTGGGGTTGCAGGGAGAAATCTAGTCTTTTGCCCAGGATTAAACTATTTAGTGTTGCTTGGTTCACTTTGTGGCTCTGGTTCCAGAACTG

AAGAGAGTTCCTTCTCACAGCCTTCCTTCAGTAACATTGCACAGCATTCTGTGGTGTGGGGACATGAGGGACACTGCCATTTGTGCCCCATGTGATATGT

GACTTATTTTGCCAGTTGAAGGTAAAATCTGGCAATTTGGGATAAGCGTGGAGTGACTGAACTGAATAAAAGTTATTTCTTCATCTTGA
Translation
MGFGSSSS SAGPNLKEWLREQFCDHPLEHCDDTRLHDAAYVGDLQTLRNLLQEESYRS - UNI34912 - SRINEKSVWCCGWLPCTPLRIAATAGH

GNCVDFLIRKGAEVDLVDVKGQTALYVAVVNGHLESTEILLEAGADPNGSRHHRSTPVYHASRVGRDDILKALIR RYGADVDVNHHLTPDTRPPFSRRL

TSLVVCPLYISAAYHNLQCFRLLLQAGANPDFNCNGPVNTQEFYRGSPGCVMDAVLRHGCEAAFVSLLVEFGANLNLVKWESLGPEARGRRKMDPEALQV

FKEARS SIPRTLLSLCRVAVRRALGKYRLHLVPSLPLPDPIKKFLLYE
Transcript ENSMUST00000027538
Sequence
GCAGTTTGGTCAACCCCGCTAATCAGCAATCAAGTCCGTTAGCCAGGCCGGAAGTGGAGACCCCAGCACCCTCCGTCCGGAGCAGGAAGTACGAAAAGGA

GGCTCATACTCCCCGGAAGCCGAGCCCTGGACACGCCCACCTGCCGGAAACGCCGGCGGTGCTTCTCTGACAGCGTTGCTCTCTGACAGGATTGCTGCGG

AGGTGGACAGGCGGCGGGGTCAGGGCGGAGGCTGAGGACCAAGTAGGCATGGCGGAGGGCGGGACCGGCCCCGATGGACGGGCCGGCCCGGGACCCGCAG

 GTCCTAATCTGAAGGAGTGGCTGAGGGAGCAGTTCTGTGACCATCCACTGGAGCACTGTGACGATACAAGACTCCATGATGCAGCCTATGTAGGGGACC

TCCAGACCCTCAGGAACCTACTGCAAGAGGAGAGCTACCGGAG - UNI34912 - CCGCATCAATGAGAAGTCTGTCTGGTGCTGCGGCTGGCTTCCC

TGCACACCACTGAGGATCGCAGCCACTGCAGGCCATGGGAACTGTGTGGACTTCCTCATACGCAAAGGGGCCGAGGTGGACCTGGTGGATGTCAAGGGGC

AGACTGCCCTGTATGTGGCTGTAGTGAACGGGCACTTGGAGAGCACTGAGATCCTTTTGGAAGCTGGTGCTGATCCCAACGGCAGCCGGCACCACCGCAG

CACTCCTGTGTACCATGCCTCTCGTGTGGGTAGGGACGACATCCTGAAGGCTCTTATCAG GTATGGGGCAGATGTTGATGTCAACCATCATCTGACTCC

TGACACCCGGCCCCCTTTTTCACGGCGGCTAACCTCCTTGGTGGTCTGTCCTCTATACATCAGTGCTGCCTACCATAACCTTCAGTGCTTCAGGCTGCTC

TTGCAGGCTGGGGCAAATCCTGACTTCAATTGCAATGGCCCTGTCAACACCCAGGAGTTCTACAGGGGATCCCCTGGGTGTGTCATGGATGCTGTCCTGC

GCCATGGCTGTGAAGCAGCCTTCGTGAGTCTGTTGGTAGAGTTTGGAGCCAACCTGAACCTGGTGAAGTGGGAATCCCTGGGCCCAGAGGCAAGAGGCAG

AAGAAAGATGGATCCTGAGGCCTTGCAGGTCTTTAAAGAGGCCAGAA GTATTCCCAGGACCTTGCTGAGTTTGTGCCGGGTGGCTGTGAGAAGAGCTCT

TGGCAAATACCGACTGCATCTGGTTCCCTCGCTGCCGCTGCCAGACCCCATAAAGAAGTTTTTGCTTTATGAGTAGCATTCACATGCAGTGCTGACTGCA

ATGTGGAAGCCGATCACCTGCAGTGAAAACTGACACAGACTCTGGCATCCTGGGAACCATGGCCTGTGCTGCCAGCTTGATCCTTGGCTGTCAGTGAAGA

AGAAACGGCTGTGTTCTCTTGGACTGTGATTCTATCTCAGGTGCTTGGGCCATCGAACGCTCCTTGAGTCATTGTCAACTGAGAGGCACATACAAACTTA

ATTTTGTTCCTCTTCAGTCTCTCTGTTTTGGATTCTTCCTGGCAATGTGTGCAGCATGGGCTGAGCCTGGTGATTGCCCTAGTGGGGAAGGCTTTTTTCT

CCAGGCTATGCATCTATTTATGTTCCTACTTTGCAATTTATTGTTCTTTTAAGGCTTGATATCAAAACAGAAAGAGGTTTGTTAAGAAAAGATATAGGGA

GAAGGAATTCGGTTCGTGCACTTGCTAGCCTGCTTTCTTGCCTGGGTTTGTCTGTCTATGCTGCCTGGTGCACATCCCTTCTCTTTGCTGCCACTGTTCT

ATTTTGGGAGTTGTCTTCCGTCTAAGATGGCTTCTGGGGTTCTATCTTATTGCACAGAGGTCCCAGAACAGTGTTCATAGGGCACCATCTGCTCTGCCAA

GGGTTTTCTGATGTCTTACCCTGGGGATCTTCAGACAGTGGTTACCTTTAGGAGACCCACCTGGAACTAACCATTAAGTGACTGCCCACATTCAGATCAG

GGACCATCTTAATAGTACTCACTGCCAGTCCTCACAAGAGAAGATGACACGGGTGCTCTCTTCAGACACTCCCATACAGGAAGTGGAAAATGTCTTGGTC

ACCTGGGTGGTTCCAGGCTACAACTTCTTGGTGTCCACTAGACAGGATATCTAGGTGTTGGGTGACTGTTCCTCCCACTTTCTGACCCAATGCCTTTGTG

GGTGCTTCTAGAGGTCTTTCCCTGTCCTGCCCAGGGCTGTTGGTGGGTGAGAGAGATGAGCTTATTGCAGGATTGCAGGTTTGTTTAACTCTTGAGTGGT

GAGTGTCACAGCAGGTGGGCCCATAACCACGGCCTTGAGCATCCTTAGGTTGCTCCTGTTTCAGTGAAGTCACCTTTTGTCATTCTGAAGCCTGTTAGGA

TTACTGTGTGGACCTTGCTGATTATAGACTTGAGAATATTTGGGACAAGCAGGTAATAAATCTGTTTAGACTTTTGGCCATAAAGGGGATTTAACTTGTT

AATACTTTCCTAGTGTACCATTTTGTGTTTTAGCTGACCAGTCAGGCAGTTGGTAGCCTTGGGATTCTGTGGATGGAGTTCCAAACCCCACCCCAGTGCC

TCAGGAAGGCCCAAGGCAGCAACACCAAGCTGGTCCAAATGTACTACATGAGTTTTGATGAGCCTTGCCCAGTCCTGGACAGTGAGTCCTGTGTCTGGGG

CAGGAATGAGCTGGCCAGAGCCTGTCCCTGTCTCCCCACAGCTGTTCTGTGTGGCCCCAGCACAGCTCTTCACTTGGACTTGAGTAGCTTTCCCTGTCTC

AAACCAGTTTTCAGAACCTTTCAATCACTTCAAGGTTCTGCATGTTCAGAATTTCCAGCCGGTAACTCTGAATGTGACACAGCATCGGCATGGACTGAGG

GCACTTCCCCTTGTCGCCAGTATGCTATGAAGGCACTGCATGTCATTGCTGTCAAGGATGAGGTACGGGGTAAGAAGCACCCCAGGTTCATGAGAGGTAC

CATAGGAAGTTGATGTGACTTCGGTGAGGACTGACCCTCTACTCAGCAGACTTCTGAGCTCTGGTTACCTGTGTCCTTCCTAGCATGGGGATGTGGGTGT

CTGATGAACCTACTGCCTTCTGGCTGAACTGGCCCTAGCAGAAGAGCTTAGTGGTCCAGAGGAAGGAGCCTGAGGGTTGTCCCAGCTCATCAAAGGGGTA

TTTGTGGGGTTGTTGCTGTTACTGGGGCAGCCACTTGATTTAAGTGAAGACTTGTGTAGTGGAATCTTGGCTAGGCAGGTTGGAACCAGTGATGATCCCT

CAGAATTTATCTTTTCAGTATTGGGCTTTTAGACATATGTCCAGAAACCTGCCAAGGCAATGCCATACATTTTGTAGCTATTTTACTTGTGATGTCTATC

TGTCTGTCTGTCTGTCTGTCTATCTATCTATCTATTAATCTATTATCTACTTATCATCTATGTATTTATGTATTTATTTGTTTATATATTTTTGTATTTA

TTTATTTATTCATATTCTTTTTCCATAAGAGGACTTAAGCTGGAGAGTCTTATTTTGTTTTGACAGTAGATTGGTAAAGTAGATAATTGGCATTTTTCAA

ATATTGACCAGTACTGATGTCAGGCTTAAGGACCATTATTTCAGAGTTTCCCCTTTTCACTTTCATGAATGAATTTTTAGATAAAAATTTCCTGAAAGAT

AAAGTCCTGACTGTGGGCCAGAGCGGAGGGAAGTTCTTCATGCCTGAGAGCTGCTCTGGCCTGTGCTCAGCCAGTTCCTGGAGCAGTGTCTGCTCTGCAG

CAGACAGGAAGAGCTCTTCCTGTGCCTTTCCAGGGACCCTGCTGAGGTCCTGTGAAGTGCCGAGGCTGCAGACACTTTGTTTGGGAGGGGTCTCTGTCCT

GAGAAAACTGCTTCCTAGTGGAAGTGCACTTACGGTGGTCACAGTGCTGAGAGCCCACAGTCTGGATTTGGGATTGACCTTGTGGGGCGGTTGGATCATC

TTGACCCACAGTGCAGCACCAACAGAGAGCCATTCGAGCAAAAGGGTAAGGGTGGCTTGTAGTACTTGAGGAAATCAAATTTCCTCAGCTGACTGGACTG

CCTTTTATTCTTCAGTCATGTCATTCCTGACAACAGAAGGCTTGCTGGAAAGGGATGGTATGGGGCTATGGCTTTGCATGTAAAACACTTTTGATTGGGA

TCCACAGCAGTGTTCTTTTCACCTCTGCCTGCTGCTGTCCTGGCACAGTCTGATTGTAGTGGATGCTACATATTAATGAGGAAGTTTTAGATCCTAAGTA

GCATTCCTGGTGGTGAAAGGCATTGTGGCTTTCCCATGGCCTGGGGTCTAAGTGTAAGCTGGAGGACCACTGTGCGCGACCTGAGGAGTCTAGACATGCT

TTTGAAGCGCCTCTACCACCCCAGATCCATGAGGTCACCACAGAAAGTGTGGCCTTTTTGGTAAGACTTGCTTGTCCTTCACTCAGGCCTTGGGAACCAG

TGGCACCTAGGATGCTGGTGATGATGTCACCAGTGGTGGTCTGCTGGTACCTGTGTCTCCTTGGTGCCTGCACACCGGGCACTTGGAGACTAATCCTGCC

CTGCAGGGATCAGATGACTTTCCATCCGCACAGAGATTCCTGGAAGTGCCTCTTGACTTGGGAGCTTCTTTCTTTCCCTTGCTCATTTTCACCTCGTTGC

TCTCCTTCCCAGAGTTCCTTGGTGTGCAATAAAGTAGTAGGTATAACTGGTTAGGGACTCTTAGTCATCTCAGGAAAGTCCCACAGATGGGTACATGCAA

GCTTTGAAGTGGGCAGTGATCTGTGGAATTTACTATACACTCCAGCCTGACATAGGACAATGGAGTGAGGAGAATGCGGGGAACTGCCGTAGCCTTAACA

GACACCCAATACCCAGTGTCAATGATGCATGGGGATCCAACCAGATCCTGTGCATGTAAGACAAGCACTCGACCACTGAGCTGTATCTTCTGCCTCTTTA

TGTCTTAGGTAAATGAAGCAATGGAAGGGTTTTTGTAAATCTCACTTGAGATTGCCATTTATGAACCTAATTGTCTTGGACATGCAATGTCAGTGCCCTG

TTCTCTCCTGCAGTGTCTGCATGGCGTCCACTACTTCTGTTGGTGTTGGGCGTGTGTAGTGTCCCGTGCACTGGGGCCTGTGTGCTTGTGCTGAAGTCGT

GCTCACTGCAGCCCTCTAGTTCCTGTTTGAGGATGAATGAGTGCTTGTTTGCAGTGCCCTGGACTGACTTGCTTTTGCCCTTGTGCCTAGTTAAGAGATT

TCAAAAGGTCAATGACTTTTTTTATACATTGTTATAATAAATGCTTTATTGCCCTCTGATTTCCTTCCCACATGCCTTAATTTTGTGGCCCGTGTCTCAC

TGAATAGAAGCTTCCTCTGTGTACAGTCTCTTATTTACATTAGTTCATCATTCATTCATTCATTCATTCATTCATTCATTCATGTGTGATGTGTGTGTCA

TCTTGTATCTGCGCTCACATATAAGCTATGGTGTGGATGTGGAGATCAAAGGACAGTGTTTGGGAGTTGGTTCTCCCAAGAGCCGAGCCTCTTATAGCCT

CCCCGTGCAGCTGTGTGCACAGTTCAAGTGGGAGGGGCTGGCTCCTGGATAGCTTCCTATGGCTGGAGAGAAGGTTCTAAAGCAGGAGTCTGTAGCTGTT

CAGTGGATCTTGGGGTTGCAGGGAGAAATCTAGTCTTTTGCCCAGGATTAAACTATTTAGTGTTGCTTGGTTCACTTTGTGGCTCTGGTTCCAGAACTGA

AGAGAGTTCCTTCTCACAGCCTTCCTTCAGTAACATTGCACAGCATTCTGTGGTGTGGGGACATGAGGGACACTGCCATTTGTGCCCCATGTGATATGTG

ACTTATTTTGCCAGTTGAAGGTAAAATCTGGCAATTTGGGATAAGCGTGGAGTGACTGAACTGAATAAAAGTTATTTCTTCATCTTGA
Translation
MAEGGTGPDGRAGPGPAG GPNLKEWLREQFCDHPLEHCDDTRLHDAAYVGDLQTLRNLLQEESYRS - UNI34912 - SRINEKSVWCCGWLPCTPL

RIAATAGHGNCVDFLIRKGAEVDLVDVKGQTALYVAVVNGHLESTEILLEAGADPNGSRHHRSTPVYHASRVGRDDILKALIR RYGADVDVNHHLTPDT

RPPFSRRLTSLVVCPLYISAAYHNLQCFRLLLQAGANPDFNCNGPVNTQEFYRGSPGCVMDAVLRHGCEAAFVSLLVEFGANLNLVKWESLGPEARGRRK

MDPEALQVFKEARS SIPRTLLSLCRVAVRRALGKYRLHLVPSLPLPDPIKKFLLYE
Transcript ENSMUST00000113020
Sequence
GCTGCTGTTGCCTCGGGAGACGCAGTTTGGTCAACCCCGCTAATCAGCAATCAAGTCCGTTAGCCAGGCCGGAAGTGGAGACCCCAGCACCCTCCGTCCG

GAGCAGGAAGTACGAAAAGGAGGCTCATACTCCCCGGAAGCCGAGCCCTGGACACGCCCACCTGCCGGAAACGCCGGCGGTGCTTCTCTGACAGCGTTGC

TCTCTGACAGGATTGCTGCGGAGGTGGACAGGCGGCGGGGTCAGGGCGGAGGCTGAGGACCAAGTAGGCATGGCGGAGGGCGGGACCGGCCCCGATGGAC

GGGCCGGCCCGGGACCCGCAG GTCCTAATCTGAAGGAGTGGCTGAGGGAGCAGTTCTGTGACCATCCACTGGAGCACTGTGACGATACAAGACTCCATG

ATGCAGCCTATGTAGGGGACCTCCAGACCCTCAGGAACCTACTGCAAGAGGAGAGCTACCGGAG - UNI34912 - CCGCATCAATGAGAAGTCTGTC

TGGTGCTGCGGCTGGCTTCCCTGCACACCACTG AGGTGGACCTGGTGGATGTCAAGGGGCAGACTGCCCTGTATGTGGCTGTAG
Translation
MAEGGTGPDGRAGPGPAG GPNLKEWLREQFCDHPLEHCDDTRLHDAAYVGDLQTLRNLLQEESYRS - UNI34912 - SRINEKSVWCCGWLPCTPL

 RWTWWMSRGRLPCMWL

For any suggestions or comments, please send an email to unitrap@crg.es