Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026313 (Hdac4)
Chromosomal location
Chr 1: 93829334 - 94044970 (-)
Description
histone deacetylase 4 Gene [Source:MGI Symbol;Acc:MGI:3036234]
RefSeq_peptide
NP_997108.1 
UniGene
Mm.318567 
MGI
MGI:3036234 
Uniprot/SWISSPROT
Q6NZM9 
Human Ortholog
ENSG00000068024 (HDAC4)
Omim not available
UniTrap UNI5465
Vector Insertion
Chr 1: 93951550 - 94044832
Public Clones (sanger) YTA243 (baygenomics) CSI198 (baygenomics) XH226 (baygenomics)
YTA344 (baygenomics) YHB119 (baygenomics) CSJ315 (baygenomics) CSI858 (baygenomics)
RRL001 (baygenomics) P025H06 (ggtc) 5SE130A12 (ggtc) 5SD175C07 (ggtc)
W023C09 (ggtc) 3SE023D02 (ggtc) 5SD115B06 (ggtc) 5SD176C06 (ggtc)
A067A04 (ggtc) 5SE062E11 (ggtc) 3SD160E11 (ggtc) F054F01 (ggtc)
3SD188A11 (ggtc) 3SD099B01 (ggtc) D055B05 (ggtc) 3SD079F12 (ggtc)
3SD176C06 (ggtc) A067B04 (ggtc) 5SE023D02 (ggtc) 5SD125G07 (ggtc)
3SD183D01 (ggtc) IST10032B8 (tigm) IST11633H7 (tigm) IST10073A8 (tigm)
IST11583G12 (tigm) IST10032B7 (tigm) IST11542A12 (tigm) IST13116D3 (tigm)
IST10031G1 (tigm) IST10060H9 (tigm) IST10471D7 (tigm)
Private Clones OST364454 (lexicon) OST37699 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6235
Vector Insertion
Chr 1: 93926774 - 93951477
Public Clones CSG447 (baygenomics) A022F04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4082
Vector Insertion
Chr 1: 93909397 - 93926531
Public Clones AP0613 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9967
Vector Insertion
Chr 1: 93898853 - 93909245
Public Clones XC490 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2498
Vector Insertion
Chr 1: 93881355 - 93884121
Public Clones XT0282 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20470
Vector Insertion
Chr 1: 93858138 - 93861356
Public Clones IST10945F6 (tigm)
Private Clones OST361114 (lexicon)
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2405
Vector Insertion
Chr 1: 93831264 - 93842476
Public Clones AC0564 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28007
Vector Insertion
Chr 1: 93829964 - 93830232
Public Clones not available
Private Clones OST42519 (lexicon)
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000008995
Sequence
CGGGCCTCCTCAATTTTGTTCCTGCATGTGCTGGTGGAAATTTGGAGTGTGTTGGAGCCACTGTTTACCTGGACATCTTGAGCCATTTTGAACTTAAGGC

ACTGACGCTGCTAGCAATGAGCTCCCAAAGCCATCCAG - UNI5465 - ATGGACTTTCTGGCCGAGACCAGCCTGTGGAGCTGCTGAATCCTGCCCG

TGTGAACCACATGCCCAGCACGG - UNI6235 - TGGACGTGGCTACAGCGCTGCCTCTGCAAGTGGCCCCTACAGCAGTACCCATGGACCTGCGCTT

GGACCACCAGTTCTCACTGCCCTTGGAACCTGCATTGCGGGAGCAGCAACTGCAGCAGGAACTCCTAGCACTGAAACAGAAGCAGCAGATCCAGCGGCAG

ATACTCATTGCAGAGTTCCAGCGTCAACATGAGCAGTTGTCCCGACAGCATGAGGCACAGTTGCATGAACATATCAAG - UNI4082 - CAGCAGCAG

GAGATGCTGGCCATGAAGCACCAGCAGGAGCTGCTGGAGCACCAGCGGAAACTGGAGCGGCACCGGCAAGAGCAGGAGCTGGAGAAGCAGCACCGTGAGC

AGAAGCTGCAGCAGCTCAAGAACAAGGAGAAGGGCAAAGAGA - UNI9967 - GTGCTGTGGCGAGCACAGAGGTGAAGATGAAGCTGCAGGAGTTTG

TTCTCAACAAGAAGAAGGCTCTAGCCCACCGGAACCTGAACCACTGCATTTCCAGCGATCCCCGCTACTGGTATGG GAAGACACAGCACAGCTCCCTTG

ACCAGAGCTCTCCACCCCAGAGTGGGGTGTCAGCCTCCTACAACCACCCCGTCTTGGGAATGTACGACGCCAAAGATGACTTCCCTCTTAGGAAAACAG 

CTTCTGAACCTAACCTGAAATTACGCTCAAGGCTTAAGCAGAAAGTAGCTGAGAGACGGAGCAGCCCCCTGTTGCGCAGGAAAGATGGCCCTGTGGCCAC

TGCTCTAAAAAAGCGACCCCTGGATGTTACAG ACTCCGCATGCAGCAGCGCCCCTGGCTCCGGTCCCAGCTCTCCAAATAGCAGCTCTGGCAACGTCAG

CACTGAGAATGGCATCGCACCCACTGTGCCCAGCGCTCCAGCTGAG - UNI2498 - ACGAGCTTGGCACACAGACTTGTGACTCGAGAAGGCTCAGT

CGCCCCACTTCCTCTCTACACGTCACCATCCTTACCCAACATCACCTTGGGACTTCCTGCCACTGGCCCTGCCGCT GGTGCGGCAGGTCAGCAGGATGC

TGAGAGGCTTGCTCTCCCAGCTCTCCAGCAGCGGATCTTGTTCCCTGGGACCCACCTCACCCCGTACCTGAGCACCTCGCCCCTGGAGAGGGACGGTGCA

GCAGCTCACAACCCCCTCCTGCAGCACATGGTCCTGCTGGAGCAGCCACCCACCCAGACACCCCTTGTCACAG GCCTGGGGGCGCTGCCCCTCCACTCA

CAGTCCCTGGTTGGTGCGGACAGGGTGTCCCCATCCATTCACAAGCTGCGGCAGCACCGCCCTCTGGGGCGCACGCAGTCAGCACCCCTGCCGCAGAACG

CACAGGCCCTGCAGCACCTGGTGATCCAGCAGCAGCACCAGCAGTTCCTGGAGAAGCACAAGCAACAGTTCCAGCAGCAGCAGCTGCACCTCAGCAAG A

TAATCTCCAAACCTAGTGAGCCACCTCGGCAGCCTGAGAGCCACCCAGAGGAGACAGAGGAGGAGCTCCGTGAGCACCAGGCCTTGCTGGATGAGCCCTA

CCTAGATCGGCTACCTGGGCAGAAGGAGCCCTCCCTGGCTGGTGTGCAGGTGAAGCAGGAGCCCATTGAGAGTGAGGAGGAAGAAGCGGAGGCCACTCGA

GAGACAGAGCCCGGCCAGCGCCCAGCCACTGAGCAGGAGCTGCTCTTCAGACAG CAAGCCCTCCTACTGGAGCAGCAGAGGATCCACCAGTTAAGAAAC

TACCAGGCATCTATGGAGGCTGCTGGCATCCCTGTGTCATTTGGCAGCCACAGACCTCTGTCTCGGGCACAGTCCTCCCCAGCATCTGCCACCTTCCCCA

TGTCAGTCCAGGAGCCCCCCACCAAGCCAAGGTTCACCACAG GTCTTGTGTATGACACACTGATGTTGAAGCATCAGTGCACCTGTGGGAACACCAACA

GCCACCCGGAGCATGCTGGGAGGATCCAGAGCATCTGGTCCCGCCTGCAGGAGACTGGACTCCGTGGCAAGTGTGAG TGCATCCGTGGACGCAAGGCCA

CATTGGAGGAGCTGCAGACAGTGCACTCGGAGGCCCACACACTCCTCTACGGCACAAATCCTCTCAACAGACAGAAACTGGACAGTAAGAAACTTCTAG 

GCTCGCTGACCTCAGTGTTCGTCAGGCTTCCTTGTGGTGGTGTTGGG - UNI20470 - GTGGATAGCGACACCATATGGAATGAGGTGCACTCGTCT

GGGGCAGCCCGCCTGGCTGTAGGCTGTGTAGTGGAGCTGGTCTTCAAGGTGGCCACGGGAGAGCTAAAG AATGGCTTTGCTGTGGTTCGTCCCCCAGGA

CACCATGCCGAGGAGAGCACACCCAT GGGTTTCTGCTACTTTAACTCCGTGGCAGTTGCAGCCAAACTTCTCCAGCAGAGGCTGAATGTGAGCAAGATC

CTCATTGTAGACTGG GATGTACATCATGGGAATGGGACCCAGCAGGCCTTCTACAATGACCCCAATGTTCTCTACATGTCCCTGCACCGCTATGACGAT

GGGAACTTCTTCCCAGGAAGTGGAGCACCAGATGAG GTGGGCACAGGGCCAGGCGTGGGTTTCAATGTCAACATGGCTTTCACGGGTGGCCTCGAACCC

CCCATGGGAGACGCTGAGTACTTGGCAGCCTTCAG AACGGTGGTTATGCCTATCGCAAATGAGTTTGCCCCAGATGTGGTACTGGTGTCATCGGGCTTC

GATGCTGTGGAGGGCCACCCCACACCTCTTGGAGGGTACAATCTCTCTGCCAAAT GTTTTGGGTACTTGACAAAACAGCTGATGGGCTTAGCTGGTGGC

CGGCTTGTGCTGGCCCTTGAGGGAGGCCATGACCTGACAGCCATCTGTGATGCTTCTGAAGCCTGCGTGTCTGCTCTGCTGGGAAACGAG - UNI2405

 - CTTGAGCCTCTGCCAGAAAAGGTTCTACATCAGAGACCCAATGCCAATGCTGTCCACTCCATGGAGAAAGTGATGGACATCCACA GCAAGTACTGG

CGCTGCCTGCAGCGTCTGTCCTCCACGGTGGGGCACTCTCTGATTGAGGCGCAAAAGTGTGAGAAGGAAGAAGCTGAGACAGTCACCGCCATGGCCTCGC

TGTCTGTAGGCGTCAAACCTGCTGAGAAGAG - UNI28007 - ATCTGAGGAGGAGCCCATGGAGGAGGAACCACCACTGTAGCCCGAAGCTGCTGTT

CTCTCCTTTGTTTGTCTGTCTTGAAGCTCAGCCAAGAAACTTACCCGTATCACTCCTGCGTCCTGCCTTGGTGCTCTCTTGAGTACAAAGGGACAGCAGG

CGTGCAGCAGCAACGGGAAGCCTTTCTGCCGCCCTGGACCACAGGTCTGGAGACGCACACGGAACACCGGGTGTGGCAGATCACATGGAACACAGGACAG

CGCGCAACACACGGGCACACAGACATGTGGAAGCCAAGCACACGCTGGTGGCTCCCCCTCCCCCTGGGAAGCCTCGAAGGAAGAAGCTTGTGGCAACTTG

GGCAGAGTTGCTGAATCAAGTTGACATGAGGAAAATGAAAATCAAAGATCTAATAATACAGAACAAACTTGATTAAAACTGGTGCTTAACATTTGATTCT

TACCCACAATCCCACAGTCTCCGTGTAAACCACTCAACTCATCTTGTAGCTTTTTTTTTTTTTTAAACGAAAACAAAACCATTTTCTATGGCTCTGGCCT

GCCTTGTGAACCTTAGTGGGGTGCTGTGGGGGTTCACAGCTTAGTGAGGGACAGAGTTGGAAGAAAGTTTAAACG
Translation
 - UNI5465 -  - UNI6235 -  - UNI4082 -  - UNI9967 - MKLQEFVLNKKKALAHRNLNHCISSDPRYWYG GKTQHSSLDQSSPPQ

SGVSASYNHPVLGMYDAKDDFPLRKTA ASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVATALKKRPLDVTD DSACSSAPGSGPSSPNSSSGNVSTEN

GIAPTVPSAPAE - UNI2498 - TSLAHRLVTREGSVAPLPLYTSPSLPNITLGLPATGPAA GAAGQQDAERLALPALQQRILFPGTHLTPYLSTSP

LERDGAAAHNPLLQHMVLLEQPPTQTPLVTG GLGALPLHSQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHLVIQQQHQQFLEKHKQQFQQ

QQLHLSK IISKPSEPPRQPESHPEETEEELREHQALLDEPYLDRLPGQKEPSLAGVQVKQEPIESEEEEAEATRETEPGQRPATEQELLFRQ QALLLE

QQRIHQLRNYQASMEAAGIPVSFGSHRPLSRAQSSPASATFPMSVQEPPTKPRFTTG GLVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRG

KCE CIRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLG GSLTSVFVRLPCGGVG - UNI20470 - VDSDTIWNEVHSSGAARLAVGCVV

ELVFKVATGELK NGFAVVRPPGHHAEESTPM MGFCYFNSVAVAAKLLQQRLNVSKILIVDW DVHHGNGTQQAFYNDPNVLYMSLHRYDDGNFFPGSG

APDE VGTGPGVGFNVNMAFTGGLEPPMGDAEYLAAFR RTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKC CFGYLTKQLMGLAGGRLVL

ALEGGHDLTAICDASEACVSALLGNE - UNI2405 - LEPLPEKVLHQRPNANAVHSMEKVMDIHS SKYWRCLQRLSSTVGHSLIEAQKCEKEEAET

VTAMASLSVGVKPAEKR - UNI28007 - RSEEEPMEEEPPL

For any suggestions or comments, please send an email to unitrap@crg.es