Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026333 (Gin1)
Chromosomal location
Chr 1: 99666745 - 99690286 (+)
Description
gross passage A viral integration region 1 Complex/Cluster/Region [Source:MGI (curated);Acc:Gin1-002]
RefSeq_dna
NM_026250 
RefSeq_peptide
NP_080526.2 
UniGene
Mm.400512 Mm.86090 
MGI
MGI:2182036 
Uniprot/SWISSPROT
Q8K259 
Human Ortholog
ENSG00000145723 (GIN1)
Omim not available
UniTrap UNI21752
Vector Insertion
Chr 1: 99666833 - 99672023
Public Clones (sanger)
Private Clones OST318972 (lexicon) OST281289 (lexicon) OST280537 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24737
Vector Insertion
Chr 1: 99673902 - 99674097
Public Clones not available
Private Clones OST208507 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32316
Vector Insertion
Chr 1: 99674717 - 99679503
Public Clones IST14576F3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19030
Vector Insertion
Chr 1: 99681800 - 99682552
Public Clones not available
Private Clones OST406702 (lexicon)
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10007
Vector Insertion
Chr 1: 99682836 - 99688873
Public Clones XE095 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112842
Sequence
AGTTCCGCTTCCGGTAGCACCAGATAAATCGCGAGAGGAGAGTTAAAAACCTGCCGTTTGCACTTAGGACCACTTCG - UNI21752 - GTTCGTGAT

GGTCCGTAGTGGGAAAAATGGTGACCTTCATCTTAAACAGATTGCATACTATAAGCGCACAGGGGAATATCACCCCACTACACTGCCGAGTGAGAGAAGC

GGCATAAGACGAGCAGCTAAGAAATTTGTCTTCAAAG - UNI24737 - AAAAAAAGCTGTTTTATGTTGGAAAAGACAGAAAACAAAATCGTTTGGT

AGTTGTTTCGGAAGAGGAGAAGAAGAAAGTACTGAGAGAGTGCCATGAGAATGGCCCTGGTGTCCATCACGGCATTTCCAGAACCCTCACTCTAGTGGAG

TCTGGCTACTACTGGACGTCCGTGACCAATGACGTCAAGCAGTGGGTATGGCTTCCACGCAGGGCTTAGGAGTGTCTTACTGTCTTTCTGATAAATACAG

AGCTCAGTGTTGCTTAAGAGGTACTGGCCATCTCACCTGTGGAGTAAGTACGTTATAGGTTATTTCTGAAATAAGAAAATATTTCAATTAAAGGTAACTT

TACTTCCCTTTATAATTACCTTACATCAGTAGAGTATAAATTAAACTAAGAAAATACAATATTTTGACAAGTTTATTGAGAATTACAGCTCCATTTTGCA

GAATTCAGTTGAAGTTGAAATTCTTTTGCTATTATATCCTTAGCACCAACGTGAATGATTTTTTTATATGATGAAAATACATCTCTTTATAATAAATCTG

TTCCAGTGTGAACTCTCAGCTTTTGTCCCTATTCTGTCTTAAGATAGAAAACTGTCAAATCAGCCAGGCTGTGGTGGTGCACATCTTTAATCCCATTGCT

TGGAAGGCAGAGGCAGGTGGATCTCTGAGTTTTAGGCCAGCATGGTCTCCAGAACAAGTTCCTGCCGGGGCAGCCAGGACCACACAGAGAAGCCCTGTCT

TGAAAAAACACAACAAGCAAACAAACAAAAACCAAACAAAAAGAGAAAGAGAGAGAGAGAGAGAG
Translation
 - UNI21752 - MVRSGKNGDLHLKQIAYYKRTGEYHPTTLPSERSGIRRAAKKFVFKE - UNI24737 - EKKLFYVGKDRKQNRLVVVSEEEKK

KVLRECHENGPGVHHGISRTLTLVESGYYWTSVTNDVKQWVWLPRRA
Transcript ENSMUST00000027571
Sequence
ACCAGATAAATCGCGAGAGGAGAGTTAAAAACCTGCCGTTTGCACTTAGGACCACTTCG - UNI21752 - GTTCGTGATGGTCCGTAGTGGGAAAAA

TGGTGACCTTCATCTTAAACAGATTGCATACTATAAGCGCACAGGGGAATATCACCCCACTACACTGCCGAGTGAGAGAAGCGGCATAAGACGAGCAGCT

AAGAAATTTGTCTTCAAAG - UNI24737 - AAAAAAAGCTGTTTTATGTTGGAAAAGACAGAAAACAAAATCGTTTGGTAGTTGTTTCGGAAGAGGA

GAAGAAGAAAGTACTGAGAGAGTGCCATGAGAATGGCCCTGGTGTCCATCACGGCATTTCCAGAACCCTCACTCTAGTGGAGTCTGGCTACTACTGGACG

TCCGTGACCAATGACGTCAAGCAGTGG - UNI24737 - - UNI32314 - AAAATAATAATGGACCAAAGAGATGAATTCATTGAACAG ATCAAT

GTAGAACTATATAGATTATTTGGTGCAAAAGAGATTGTAATTTCTCGTGCTTCTGGAAGTGTTAATCCAGCTGAAAACACACCTAGCACCATCAAAACAT

TCCTCTCCAAACACTGTGCCGACCACCCCAACAGCTGGGATGAGCATCTGCCAGCCCTTTCCTTTGCCTTCAATGTCACTCACTTG GAGCCTAATAAAA

ACACACCGTATTTCCAAATGTTCAATCGGAATCCTTGCGTGTTGGAGTGTCCTCCTGAAGAGGGCAGTGAAGGTACAAGTGTGTTTGCCAGAATCGTAGC

TGCGATTAGAGAGGCTGATGGCGTGGTGGAGAACAAGACACCAGCATCGAGCCAG - UNI19030 - ATGGAGAACAACAATTCGGATGAACTGAGTA

AAAGCAAAGTTGTTAAAAAGAAAGCAAAGCAGTTAAATCCCTTTCATTTGAAAGTGGGTCATGAGGTTTTACGACAGAGGAAGAACTGGTGGAAGGATGG

CCGCTTCCAGTCTGAGTGGGTCGGGCCTTGTGTCATCGACTACATTACAGAAAGTGGATGTGCTGTCCTCAGAGATAACACGGGAACCAGACTCAAACGA

CCTATCAAAATGTCCCACCTTAGGCCCTATGTGAGAGAGTCCAGTGAGCAGG - UNI10007 - ACAGTCTTTATCTCTTGCAAGGTTCGATAGTGGC

AGATCACGACTACATTGGATTACCTGAGATCCCAGTTGGAACATACCAGGCAAATATTCTGGTAGAAGATGCAACTATTGGGATAGCTGATAATGAACTA

TTGATATCAAGCAAGGATCATGAACTCTTAGAATATAGAAATTCCAAAATCTCTGCATTGGTAGAAGACCACAGTTCTCTTGAGAAACAGACTTTTAGCC

TACTGGATTCTTCAAATCAAGTTCTCGAGTACTTAAGTTAGTAAATACCAAAATTAATGTAAAATGCTTGCACAGAATGTATATATTTCTAGTTTGTAAG

TATTTTATCTATTAAAATAGGTTGTATAGAAGAGAGATCTTGGTACTATGTTAATAACTAAATTCTGAAAGCTTATTTTAAACCTTCCTAAAGTTGTTAC

ATGTTTGAATACAAATAAATATATGTAACAGAAGTATACCATGCGTAGAATTCAGAAATTTCTCAGAAAACAGACAAAATACGTTGTTAGAAAATAAATT

CTCGTGGAGAAGTCTCACCTTTTTCTATATGGGTACTACATTTTCTCTTTTAACTTTTCAGCAATACATACCCCTTTTAAATAAATTTAAACTAATTATA

GCTTAGTTAATAAATGTTGAGTGAACAATAACATAAATGAAACGAAACTTTATCTGTGACATTGGAACTTTTTAAATTTGTATTTGTGTGTGTCTGTGTG

TGTCTGTGTGTGCGCGCGCGCATGTGCATGTATACGTGTGTTTCTGAGTGAGGCTTTATGTATGTGAGTACAGTGCCCTAGTGTAAAGGCTAGGCAAGGG

TATTGGATATGCTGAAGCTGAAGTTACAGGTGATTGGGCACCAACCAGGTTGAGTACTGGGAACCACACTAGGATCCACTGCACCAGCAGAGCACACTCC

AGCTGAAGGACAAGTGACTGTCAGGGAAAGAATGAAGTCTCTGACCTTGTACACAAACCAAAGACATTGCAGATAGAATTCTAGAAAGAAACTAAAACAG

AGTGGTGCTAGTAGGCTTTGCCTACTCTCCTCTACAGAGCAGAGTTCAGGAAGGGAGCCTACTGCAGTGCCTACATGGTCGATAAAGTGATTGTCTCTTT

GTCACCTCAATGAAGTCACTTTCTTCTAAGATTCTTTTCGAGATCATCTGACTTGAATTTGTCCTATTTTACTTGTTCTATTTAAGGAGGCCAATTAGCT

TTCAGATTGATTTCTCGGTGGAAGATTCTAAATAGCTAAAAATAATGTTTTCCCTTCCTAAGTAATTTCCCATCAGATTTTTGCTTTGTGTGTATGTGAG

TCATATCAGGCTACATTATTCTTCTTGCAAATCATCCCCAGATCTTAGTAGCTTAAAACAATAAAGCTTTATTTCTTGA
Translation
 - UNI21752 - MVRSGKNGDLHLKQIAYYKRTGEYHPTTLPSERSGIRRAAKKFVFKE - UNI24737 - EKKLFYVGKDRKQNRLVVVSEEEKK

KVLRECHENGPGVHHGISRTLTLVESGYYWTSVTNDVKQW - UNI24737 - - UNI32314 - KIIMDQRDEFIEQ INVELYRLFGAKEIVISRA

SGSVNPAENTPSTIKTFLSKHCADHPNSWDEHLPALSFAFNVTHL EPNKNTPYFQMFNRNPCVLECPPEEGSEGTSVFARIVAAIREADGVVENKTPAS

SQ - UNI19030 - MENNNSDELSKSKVVKKKAKQLNPFHLKVGHEVLRQRKNWWKDGRFQSEWVGPCVIDYITESGCAVLRDNTGTRLKRPIKMSHL

RPYVRESSEQD - UNI10007 - DSLYLLQGSIVADHDYIGLPEIPVGTYQANILVEDATIGIADNELLISSKDHELLEYRNSKISALVEDHSSLEKQ

TFSLLDSSNQVLEYLS
Transcript ENSMUST00000112844
Sequence
CGACCCCCGGCAGTTCCGCTTCCGGTAGCACCAGATAAATCGCGAGAGGAGAGTTAAAAACCTGCCGTTTGCACTTAGGACCACTTCG - UNI21752 

- GTTCGTGATGGTCCGTAGTGGGAAAAATGGTGACCTTCATCTTAAACAGATTGCATACTATAAGCGCACAGGGGAATATCACCCCACTACACTGCCGA

GTGAGAGAAGCGGCATAAGACGAGCAGCTAAGAAATTTGTCTTCAAAG - UNI24737 - AAAAAAAGCTGTTTTATGTTGGAAAAGACAGAAAACAA

AATCGTTTGGTAGTTGTTTCGGAAGAGGAGAAGAAGAAAGTACTGAGAGAGTGCCATGAGAATGGCCCTGGTGTCCATCACGGCATTTCCAGAACCCTCA

CTCTAGTGGAGTCTGGCTACTACTGGACGTCCGTGACCAATGACGTCAAGCAGTGG - UNI24737 - - UNI32314 - GTATATGCTTGTCAGCA

TTGCCAAGTAGCAAAAAATACAGTTATCGTAGCACCTCAGCAGCACCTTCCCATGGTGGGAAACCCGTGGAGTGTAGTTACTGTTGATCTGATGGGACCT

TTCCATACAAGCAACAGAAGTCATGTGTATGCTATAATCATGACAGATTTGTTCACAAAATGGGTTATGATTTTGCCTTTATGTGATGTTTCAGCATCAG

AAATTTCTAAAGCTATTATCAATATATTTTTTCTATATGGACCTCCTCAGAAAATAATAATGGACCAAAGAGATGAATTCATTGAACAG ATCAATGTAG

AACTATATAGATTATTTGGTGCAAAAGAGATTGTAATTTCTCGTGCTTCTGGAAGTGTTAATCCAGCTGAAAACACACCTAGCACCATCAAAACATTCCT

CTCCAAACACTGTGCCGACCACCCCAACAGCTGGGATGAGCATCTGCCAGCCCTTTCCTTTGCCTTCAATGTCACTCACTTG GAGCCTAATAAAAACAC

ACCGTATTTCCAAATGTTCAATCGGAATCCTTGCGTGTTGGAGTGTCCTCCTGAAGAGGGCAGTGAAGGTACAAGTGTGTTTGCCAGAATCGTAGCTGCG

ATTAGAGAGGCTGATGGCGTGGTGGAGAACAAGACACCAGCATCGAGCCAG - UNI19030 - ATGGAGAACAACAATTCGGATGAACTGAGTAAAAG

CAAAGTTGTTAAAAAGAAAGCAAAGCAGTTAAATCCCTTTCATTTGAAAGTGGGTCATGAGGTTTTACGACAGAGGAAGAACTGGTGGAAGGATGGCCGC

TTCCAGTCTGAGTGGGTCGGGCCTTGTGTCATCGACTACATTACAGAAAGTGGATGTGCTGTCCTCAGAGATAACACGGGAACCAGACTCAAACGACCTA

TCAAAATGTCCCACCTTAGGCCCTATGTGAGAGAGTCCAGTGAGCAGG - UNI10007 - ACAGTCTTTATCTCTTGCAAGGTTCGATAGTGGCAGAT

CACGACTACATTGGATTACCTGAGATCCCAGTTGGAACATACCAGGCAAATATTCTGGTAGAAGATGCAACTATTGGGATAGCTGATAATGAACTATTGA

TATCAAGCAAGGATCATGAACTCTTAGAATATAGAAATTCCAAAATCTCTGCATTGGTAGAAGACCACAGTTCTCTTGAGAAACAGACTTTTAGCCTACT

GGATTCTTCAAATCAAGTTCTCGAGTACTTAAGTTAGTAAATACCAAAATTAATGTAAAATGCTTGCACAGAATGTATATATTTCTAGTTTGTAAGTATT

TTATCTATTAAAATAGGTTGTATAGAAGAGAGATCTTGGTACTATGTTAATAACTAAATTCTGAAAGCTTATTTTAAACCTTCCTAAAGTTGTTACATGT

TTGAATACAAATAAATATATGTAACAGAAGT
Translation
 - UNI21752 - MVRSGKNGDLHLKQIAYYKRTGEYHPTTLPSERSGIRRAAKKFVFKE - UNI24737 - EKKLFYVGKDRKQNRLVVVSEEEKK

KVLRECHENGPGVHHGISRTLTLVESGYYWTSVTNDVKQW - UNI24737 - - UNI32314 - VYACQHCQVAKNTVIVAPQQHLPMVGNPWSVVT

VDLMGPFHTSNRSHVYAIIMTDLFTKWVMILPLCDVSASEISKAIINIFFLYGPPQKIIMDQRDEFIEQ INVELYRLFGAKEIVISRASGSVNPAENTP

STIKTFLSKHCADHPNSWDEHLPALSFAFNVTHL EPNKNTPYFQMFNRNPCVLECPPEEGSEGTSVFARIVAAIREADGVVENKTPASSQ - UNI190

30 - MENNNSDELSKSKVVKKKAKQLNPFHLKVGHEVLRQRKNWWKDGRFQSEWVGPCVIDYITESGCAVLRDNTGTRLKRPIKMSHLRPYVRESSEQD

 - UNI10007 - DSLYLLQGSIVADHDYIGLPEIPVGTYQANILVEDATIGIADNELLISSKDHELLEYRNSKISALVEDHSSLEKQTFSLLDSSNQV

LEYLS

For any suggestions or comments, please send an email to unitrap@crg.es