Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026349 (Ccnt2)
Chromosomal location
Chr 1: 129670741 - 129702509 (+)
Description
cyclin T2 Gene [Source:MGI (curated);Acc:Ccnt2-002]
RefSeq_dna
NM_028399 
RefSeq_peptide
NP_082675.1 
UniGene
Mm.268672 Mm.448806 
MGI
MGI:1920199 
Uniprot/SPTREMBL
Q9D6H3 Q3U832 Q7TQK0 
Human Ortholog
ENSG00000082258 (CCNT2)
Omim not available
UniTrap UNI10980
Vector Insertion
Chr 1: 129671760 - 129688181
Public Clones (sanger) P151F01 (ggtc) E037A02 (ggtc) P146G03 (ggtc) E031F07 (ggtc)
IST15003E11 (tigm) IST14929G10 (tigm) IST13878H10 (tigm)
Private Clones OST451995 (lexicon) OST451106 (lexicon) OST437433 (lexicon) OST437425 (lexicon)
OST426213 (lexicon) OST396492 (lexicon) OST374552 (lexicon) OST358204 (lexicon)
OST341535 (lexicon) OST339174 (lexicon) OST325036 (lexicon) OST319322 (lexicon)
OST241868 (lexicon) OST237465 (lexicon) OST188014 (lexicon) OST182816 (lexicon)
OST151579 (lexicon) OST150858 (lexicon) OST149535 (lexicon) OST88688 (lexicon)
OST87682 (lexicon) OST84280 (lexicon) OST65832 (lexicon) OST63771 (lexicon)
OST57890 (lexicon) OST57436 (lexicon) OST43498 (lexicon) OST42660 (lexicon)
OST39646 (lexicon) OST34173 (lexicon) OST32401 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18456
Vector Insertion
Chr 1: 129688311 - 129689934
Public Clones not available
Private Clones OST423064 (lexicon) OST213450 (lexicon) OST207243 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27225
Vector Insertion
Chr 1: 129689996 - 129691831
Public Clones not available
Private Clones OST66288 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10645
Vector Insertion
Chr 1: 129696131 - 129698182
Public Clones W048F02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112570
Sequence
CGCGGAGTCCCGGAGGCAGGCGGGGAGGGGGCGGGCTCAGGGCGCGGGCGGAGGAGGAAGTGTCATGGCGTCGGGCCGTGGAGCTTCTTCTCGCTGGTTC

TTTACTCGGGAACAGCTGGAGAACACGCCGAGCCGCCGCTGCGGAGTGGAAGCGGATGAAGAGCTGTCGCATCGCCAGCAGGCGGCCAACCTCATCCAGG

ACATGGGGCAACGTCTCAATGT CTCTCAGCTTACAATAAACACTGCGATTGTTTATATGCACAGGTTTTATATGCACCATTCCTTCACCAAATTCAACA

GAAAT - UNI10980 - ATAATATCACCTACTGCATTGTTTTTGGCTGCAAAAGTGGAAGAGCAGGCTCGAAAGCTTGAACATGTTATCAAAGTAGCA

CACGCTTGTCTTCATCCCCTAGAGCCACTCCTGGACACAAAATGTGAT - UNI18456 - GCTTATCTTCAGCAGACTCAAGAACTGGTTTTACTTGA

AACCATAATGCTACAAACACTGG - UNI27225 - GTTTTGAGATCACCATTGAACACCCACACACAGATGTGGTGAAATGCACCCAGTTAGTAAGAG

 CAAGCAAGGATTTGGCACAGACATCCTATTTCATGGCTACCAACAG TTTGCATCTTACGACCTTCTGTCTTCAGTACAAACCCACAGTGATAGCATGT

GTATGCATTCATTTGGCTTGCAAATGGTCCAATTGGGAGATTCCTGTGTCAACAGATGGAAAGCACTGGTGGGAGTATGTGGACCCCACGGTTACCCTAG

AGCTGCTAGATG - UNI10645 - AACTAACACATGAGTTTCTACAAATATTGGAGAAAACGCCTAGTAGGTTGAAGAGGATTCGAAACTGGAGG GC

TATGGCTAAGAAACCAAAAGTAGATGGACAAGTATCAGAGACACCACTGCTTGGTTCATCTTTGGTCCAGAATTCTATTTTAGTAGATAGTGTCACTGGT

GTACCTGCCAACCCAAGCTTTCAGAAACCATCAACATCAACGTTCCCTGCTCCAATACCTCTAAATTCAGGAAGTACTTCTGTTCAAGATAGCCGTGCAT

CTGATAATTTATCAGTGCTAGCAGCAGGAATGCCCAGTACCTCATACAGTTTGTCATCACACCAAGAGTGGCCCCAGCATCCAGATTCAGCCAGGACAGA

CCCAGTGTACACACAGAAACAGGAGGCCACTCTCTCTGGGAGCCAGTACATAAGCTTCCAGCAGGGACCTTCAATGGCACTGCATTCTGGATTACATCAC

AGGCCGGACAAAGTTGCTGATCATTCATCAGCTAAGCAAGAATATACTCACAAAGCTGGGAGCAGTAAACACCATGGTCCCATACCTGCTACTCCTGGAA

TGCTTCCTCAGAAAATGTCTTTAGATAAGTACAGAGAGAAGCGGAAGCTGGAAACCCTTGACGTGGACACAAGGGATCACTATCTAGCTGCCCATGCAGA

ACAGCAGCACAAGCATGGGCCGGCTCAGGCAGTCACGGGCACTTCTGTCACTTCTCCCATCAAGATGAAGCTCCCCCTCACCAACTCGGACAGGCCTGAG

AAACACGTGGCAGAGAAAAAGGAGAGGAGTGGATCACTGAAGCTCCGCATTCCCATCCCCCCGCCTGACAAAGGTCCCAGCAAAGAGGAGCTGAAGATGA

AAATCAAAGTGGCATCCTCGGAAAGACACAGCTCTTCTGATGAAGGCAGTGGGAAGAGCAAGCACTCAAGCCCACACATCAGCAGAGACCACAAGGAGAA

GCACAAGGAGCACCCTGCCAACCGCCACCACAGCAGCCACAAGTATTTGCACATGCACAGTGGAGGCAGTAAGCACACAGCGGATGGAATGCCTCCCACG

GTGCTCAGGAGTCCTGTGGGCCTGGGCCCTGAAGGCGTCTCCTCCGCCTCCAGTGCAAGGAAGAAGCTGCATAGCAGCGAAGCCTCCCACAACCACCACT

CCAAAATGAGCAAAAGTTCCAAAAGTGCAG GTGGGCTACGGACATCTCAGCACCCTCGTGAAACTGGACAAGAAACCAGTGGAGCCCCACGGTCCTGAG

GCCAATCACGAGTACAGTACAAGCAGCCAGCATATGGACTACAAAGACACATTCGACATGCTGGACTCGCTGCTAAGTGCCCAAGGAATGAATATGTAAC

CTTTGTTTAGGTCAACTTTTCCTTGCCTTTTTAATTTAAAAATGGTTGGAATGGAAAACGCCCTCCTGGTCCGGCGGTGGTGCCACTGCTTCCATATTTG

TAAGTGCTGCTTTGTTCTTCATTCTGAAAGAAGAGATGATAGTAAACAAGCCTATCTCCACATACGATAGTGTTACCAGGACTGTAACCGCATGGAAGAT

GCAGCTGAGAACATTAGGATGAATGGCTGGCTGCTGCTAGGAGCCTAAGCTGCTTCAAGCTTCTCTTATTTATGATTTGAATATTGTAGCTGTTTTTTGT

TGTTGCTTGGCTTTGAATGAGTGTCAGTTGTTTTCTTTTGTGTATTTATACTTGTATGTATGGTTTGCATGTCTCAGTGATAAAGGGATAAAACAGTATA

CTGACAGCTGTTTACAAGAAAGTGGAGAAAAATGTACATACATTTTTGTATGTTTAGATATTACCATAAATACTCAGGATTGGAGCTGCTTGTAAGAATA

ACAATATACAGAATAACTTTATTTTCTCTCGTCAGAGTCCATCACTAATCTAAAACACAAGTGGCACTTTTTTTATGTTAACCTTAATTAAACTCTAGGC

CTTACTGGAAGCCGCTGAGGGGACACTTCACTACTAGACGGGAATGTGGTGCCATGGGTGGTCCTTAACACTGGGAAGCACTCAGTTTGCCTTCAGAGGT

CCTGACCAGATTGGCTGCAGAATCAGCCGTTGATTTCTGAAGGCTTGAAGAGGAAAACACAATAAAGTTTACATACTCTTGATGTGAAGTGCATTTAAAT

GTTTGTTGGCTTGTTGCAGTGCTGTAGAAAGCAGCTAATAATTGGTGTGAGGATGACTGTGACTTTGCTCACAGCAGCTCCCAGTGAAGATGAGTCCATT

TCTTCAGGAACGCTGACACTACAGATTCTAAGAGTGAACAGGGGTCACTTTTCCTTTAGCATTGCAGTGACACCATAGTCTTGAATATACTCTTCCCATG

GAGAGAGAGAGTGAGTGTGTATGTGAGAGAGAGTGTGAGTGTGTGGGTATGGGTGTGAGGGAGAGATACCATATTTCTTTTTCAGGTAAATGCAGTCTTC

CTTATAAAAATGAAATTAAACCTATGCTCTCTTGATTCTTTTATATTCTAACAATAAATAAAAAAGAAAAGATTGCTGACTGTGCATTGTACCTGTATTT

ATAGCTTATGGTCATTATCAGGAAAATGTAAGGAAAAAGGCCAGCCTCAGGCAAGCCACTGCTGGGGTTTTACATGCTGGGGTTTTACATGCGTTTGCAC

GTCTTAGTAGGTTCTCATTGAGGTAATGCTTGCACTGTCACCTGACGCCTTGTCAGGGGATAGACTGACTTGTCTAAATTTTGGTATAAGCACCAATAGT

ATGGCTCTTGTCTCTTGCCTAACCTTGAATTTATTTCTGTGGTAAGTCTTAGCTGTTGAGTCTCTTAAGATGGGTCGGGTTCAACTTGTATTGAATCACA

AGTTTTCCTCTGTATATGAAATGTTTTGTTATAAAGCCACTGATCTGTGCACAATTGTAATTTTATTCAAGTATGTTGTGGTTGTAAATATTAGAGTTGA

GCCTTGTACTCTACTTTTATTTAGCAGTTATCCCATTTGCCAGTAGCTATTTGTTTTTTAAAGAAAATTGTTGATTATTTTGTCAATGTTATTTGAACCT

GGGATGTCAGGAGCTTCTTTGTGGGAACTCAGCCTAGCAGGCTAGTCCTCACTCTGTTCTTGTTTCATTGGTAATCTTTGTTACTATGTGATTTTTGTTG

CTGTGGTATACTGTTGTATCATAAACATGATGATTTTGATACAGTTACAGTTTTACCGTGGTACATTTCCAAGAACTAGCATAGGATTTAAACAGAGTAC

AAGGCGAGGGAGGGAAGGGTTTTGTTCTTGGTGATTTAGATGTGAAACCTCAACAGAGCATCATGTGAATTGACATGAGGTGGTCGTGCTACTGTATCAT

TGGGAGTGACCCAGGAATTTTAATCAGCCTTTGTAAAGAGTATCCAGAGACGTAGCAAACTTATTTTCAGTATGACATAGAAAACAATGTGAATATTTAA

GGTCTGGGACTGTAGTTAAACTTCACTAAGGATTTTCAGAAATGTGTTGTTTTTTGTTTGTTGTTTTGTTTTTTAGATATGGGAATAAAGGTAATTTTGT

TGAATCTTCATTGGTGCTAATGATGGACAGTTAAACAGATAGTGTCTACGCTGTGGATAAGTACACTTAGTGCTTCCAGAACTGACTTTGAAATGCTGTG

TATTCACTTCTCACTCTGTAAATGTAATTCTTTACAATGACTATTTATTAAAAGGCAGTCAGTGTGATTTTT
Translation
MASGRGASSRWFFTREQLENTPSRRCGVEADEELSHRQQAANLIQDMGQRLNV VSQLTINTAIVYMHRFYMHHSFTKFNRN - UNI10980 - IISP

TALFLAAKVEEQARKLEHVIKVAHACLHPLEPLLDTKCD - UNI18456 - AYLQQTQELVLLETIMLQTLG - UNI27225 - GFEITIEHPHTD

VVKCTQLVRA ASKDLAQTSYFMATNS SLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPTVTLELLDE - UNI10645 - EL

THEFLQILEKTPSRLKRIRNWR AMAKKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPANPSFQKPSTSTFPAPIPLNSGSTSVQDSRASDNLSVLAAG

MPSTSYSLSSHQEWPQHPDSARTDPVYTQKQEATLSGSQYISFQQGPSMALHSGLHHRPDKVADHSSAKQEYTHKAGSSKHHGPIPATPGMLPQKMSLDK

YREKRKLETLDVDTRDHYLAAHAEQQHKHGPAQAVTGTSVTSPIKMKLPLTNSDRPEKHVAEKKERSGSLKLRIPIPPPDKGPSKEELKMKIKVASSERH

SSSDEGSGKSKHSSPHISRDHKEKHKEHPANRHHSSHKYLHMHSGGSKHTADGMPPTVLRSPVGLGPEGVSSASSARKKLHSSEASHNHHSKMSKSSKSA

G GGLRTSQHPRETGQETSGAPRS
Transcript ENSMUST00000027587
Sequence
CGCGGAGTCCCGGAGGCAGGCGGGGAGGGGGCGGGCTCAGGGCGCGGGCGGAGGAGGAAGTGTCATGGCGTCGGGCCGTGGAGCTTCTTCTCGCTGGTTC

TTTACTCGGGAACAGCTGGAGAACACGCCGAGCCGCCGCTGCGGAGTGGAAGCGGATGAAGAGCTGTCGCATCGCCAGCAGGCGGCCAACCTCATCCAGG

ACATGGGGCAACGTCTCAATGT CTCTCAGCTTACAATAAACACTGCGATTGTTTATATGCACAGGTTTTATATGCACCATTCCTTCACCAAATTCAACA

GAAAT - UNI10980 - ATAATATCACCTACTGCATTGTTTTTGGCTGCAAAAGTGGAAGAGCAGGCTCGAAAGCTTGAACATGTTATCAAAGTAGCA

CACGCTTGTCTTCATCCCCTAGAGCCACTCCTGGACACAAAATGTGAT - UNI18456 - GCTTATCTTCAGCAGACTCAAGAACTGGTTTTACTTGA

AACCATAATGCTACAAACACTGG - UNI27225 - GTTTTGAGATCACCATTGAACACCCACACACAGATGTGGTGAAATGCACCCAGTTAGTAAGAG

 CAAGCAAGGATTTGGCACAGACATCCTATTTCATGGCTACCAACAG TTTGCATCTTACGACCTTCTGTCTTCAGTACAAACCCACAGTGATAGCATGT

GTATGCATTCATTTGGCTTGCAAATGGTCCAATTGGGAGATTCCTGTGTCAACAGATGGAAAGCACTGGTGGGAGTATGTGGACCCCACGGTTACCCTAG

AGCTGCTAGATG - UNI10645 - AACTAACACATGAGTTTCTACAAATATTGGAGAAAACGCCTAGTAGGTTGAAGAGGATTCGAAACTGGAGG GC

TATGGCTAAGAAACCAAAAGTAGATGGACAAGTATCAGAGACACCACTGCTTGGTTCATCTTTGGTCCAGAATTCTATTTTAGTAGATAGTGTCACTGGT

GTACCTGCCAACCCAAGCTTTCAGAAACCATCAACATCAACGTTCCCTGCTCCAATACCTCTAAATTCAGGAAGTACTTCTGTTCAAGATAGCCGTGCAT

CTGATAATTTATCAGTGCTAGCAGCAGGAATGCCCAGTACCTCATACAGTTTGTCATCACACCAAGAGTGGCCCCAGCATCCAGATTCAGCCAGGACAGA

CCCAGTGTACACACAGAAACAGGAGGCCACTCTCTCTGGGAGCCAGTACATAAGCTTCCAGCAGGGACCTTCAATGGCACTGCATTCTGGATTACATCAC

AGGCCGGACAAAGTTGCTGATCATTCATCAGCTAAGCAAGAATATACTCACAAAGCTGGGAGCAGTAAACACCATGGTCCCATACCTGCTACTCCTGGAA

TGCTTCCTCAGAAAATGTCTTTAGATAAGTACAGAGAGAAGCGGAAGCTGGAAACCCTTGACGTGGACACAAGGGATCACTATCTAGCTGCCCATGCAGA

ACAGCAGCACAAGCATGGGCCGGCTCAGGCAGTCACGGGCACTTCTGTCACTTCTCCCATCAAGATGAAGCTCCCCCTCACCAACTCGGACAGGCCTGAG

AAACACGTGGCAGAGAAAAAGGAGAGGAGTGGATCACTGAAGCTCCGCATTCCCATCCCCCCGCCTGACAAAGGTCCCAGCAAAGAGGAGCTGAAGATGA

AAATCAAAGTGGCATCCTCGGAAAGACACAGCTCTTCTGATGAAGGCAGTGGGAAGAGCAAGCACTCAAGCCCACACATCAGCAGAGACCACAAGGAGAA

GCACAAGGAGCACCCTGCCAACCGCCACCACAGCAGCCACAAGTATTTGCACATGCACAGTGGAGGCAGTAAGCACACAGCGGATGGAATGCCTCCCACG

GTGCTCAGGAGTCCTGTGGGCCTGGGCCCTGAAGGCGTCTCCTCCGCCTCCAGTGCAAGGAAGAAGCTGCATAGCAGCGAAGCCTCCCACAACCACCACT

CCAAAATGAGCAAAAGTTCCAAAAGTGCAGGTAGTTCATCTAGTTCTTCCTCTGTTAAGCAGTATCTATCCTCTCACAGCTCTGTTTTTAACCATCCCTT

ACCCCCTCCTCCCCCTGTCACATACCAGGTGGGCTACGGACATCTCAGCACCCTCGTGAAACTGGACAAGAAACCAGTGGAGCCCCACGGTCCTGAGGCC

AATCACGAGTACAGTACAAGCAGCCAGCATATGGACTACAAAGACACATTCGACATGCTGGACTCGCTGCTAAGTGCCCAAGGAATGAATATGTAACCTT

TGTTTAGGTCAACTTTTCCTTGCCTTTTTAATTTAAAAATGGTTGGAATGGAAAACGCCCTCCTGGTCCGGCGGTGGTGCCACTGCTTCCATATTTGTAA

GTGCTGCTTTGTTCTTCATTCTGAAAGAAGAGATGATAGTAAACAAGCCTATCTCCACATACGATAGTGTTACCAGGACTGTAACCGCATGGAAGATGCA

GCTGAGAACATTAGGATGAATGGCTGGCTGCTGCTAGGAGCCTAAGCTGCTTCAAGCTTCTCTTATTTATGATTTGAATATTGTAGCTGTTTTTTGTTGT

TGCTTGGCTTTGAATGAGTGTCAGTTGTTTTCTTTTGTGTATTTATACTTGTATGTATGGTTTGCATGTCTCAGTGATAAAGGGATAAAACAGTATACTG

ACAGCTGTTTACAAGAAAGTGGAGAAAAATGTACATACATTTTTGTATGTTTAGATATTACCATAAATACTCAGGATTGGAGCTGCTTGTAAGAATAACA

ATATACAGAATAACTTTATTTTCTCTCGTCAGAGTCCATCACTAATCTAAAACACAAGTGGCACTTTTTTTATGTTAACCTTAATTAAACTCTAGGCCTT

ACTGGAAGCCGCTGAGGGGACACTTCACTACTAGACGGGAATGTGGTGCCATGGGTGGTCCTTAACACTGGGAAGCACTCAGTTTGCCTTCAGAGGTCCT

GACCAGATTGGCTGCAGAATCAGCCGTTGATTTCTGAAGGCTTGAAGAGGAAAACACAATAAAGTTTACATACTCTTGATGTGAAGTGCATTTAAATGTT

TGTTGGCTTGTTGCAGTGCTGTAGAAAGCAGCTAATAATTGGTGTGAGGATGACTGTGACTTTGCTCACAGCAGCTCCCAGTGAAGATGAGTCCATTTCT

TCAGGAACGCTGACACTACAGATTCTAAGAGTGAACAGGGGTCACTTTTCCTTTAGCATTGCAGTGACACCATAGTCTTGAATATACTCTTCCCATGGAG

AGAGAGAGTGAGTGTGTATGTGAGAGAGAGTGTGAGTGTGTGGGTATGGGTGTGAGGGAGAGATACCATATTTCTTTTTCAGGTAAATGCAGTCTTCCTT

ATAAAAATGAAATTAAACCTATGCTCTCTTGATTCTTTTATATTCTAACAATAAATAAAAAAGAAAAGATTGCTGACTGTGCATTGTACCTGTATTTATA

GCTTATGGTCATTATCAGGAAAATGTAAGGAAAAAGGCCAGCCTCAGGCAAGCCACTGCTGGGGTTTTACATGC
Translation
MASGRGASSRWFFTREQLENTPSRRCGVEADEELSHRQQAANLIQDMGQRLNV VSQLTINTAIVYMHRFYMHHSFTKFNRN - UNI10980 - IISP

TALFLAAKVEEQARKLEHVIKVAHACLHPLEPLLDTKCD - UNI18456 - AYLQQTQELVLLETIMLQTLG - UNI27225 - GFEITIEHPHTD

VVKCTQLVRA ASKDLAQTSYFMATNS SLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPTVTLELLDE - UNI10645 - EL

THEFLQILEKTPSRLKRIRNWR AMAKKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPANPSFQKPSTSTFPAPIPLNSGSTSVQDSRASDNLSVLAAG

MPSTSYSLSSHQEWPQHPDSARTDPVYTQKQEATLSGSQYISFQQGPSMALHSGLHHRPDKVADHSSAKQEYTHKAGSSKHHGPIPATPGMLPQKMSLDK

YREKRKLETLDVDTRDHYLAAHAEQQHKHGPAQAVTGTSVTSPIKMKLPLTNSDRPEKHVAEKKERSGSLKLRIPIPPPDKGPSKEELKMKIKVASSERH

SSSDEGSGKSKHSSPHISRDHKEKHKEHPANRHHSSHKYLHMHSGGSKHTADGMPPTVLRSPVGLGPEGVSSASSARKKLHSSEASHNHHSKMSKSSKSA

GSSSSSSSVKQYLSSHSSVFNHPLPPPPPVTYQVGYGHLSTLVKLDKKPVEPHGPEANHEYSTSSQHMDYKDTFDMLDSLLSAQGMNM

For any suggestions or comments, please send an email to unitrap@crg.es