Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026353 (Ubxn4)
Chromosomal location
Chr 1: 130140758 - 130175954 (+)
Description
UBX domain protein 4 Gene [Source:MGI Symbol;Acc:MGI:1915062]
RefSeq_dna
NM_026390 
RefSeq_peptide
NP_080666.2 
UniGene
Mm.293321 
MGI
MGI:1915062 
Uniprot/SWISSPROT
Q8VCH8 
Uniprot/SPTREMBL
Q05C23 Q3UFS2 Q3ULE5 Q6ZQF6 Q8C0Z0 Q9CRQ1 Q9CT42 
Human Ortholog
ENSG00000144224 (UBXN4)
Omim not available
UniTrap UNI21514
Vector Insertion
Chr 1: 130141130 - 130148779
Public Clones not available
Private Clones OST327735 (lexicon) OST248751 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29388
Vector Insertion
Chr 1: 130148883 - 130152009
Public Clones NAISTrap_26v1018 (NAISTrap)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9929
Vector Insertion
Chr 1: 130155581 - 130156020
Public Clones XC059 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1095
Vector Insertion
Chr 1: 130159535 - 130162866
Public Clones CE0136 (sanger) PST24512-NR (escells)
Private Clones OST9042 (lexicon)
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11609
Vector Insertion
Chr 1: 130162992 - 130166445
Public Clones E139C01 (ggtc) P025A09 (ggtc) PST9654-NL (escells) IST10260D8 (tigm)
Private Clones OST39555 (lexicon) OST25133 (lexicon)
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16430
Vector Insertion
Chr 1: 130166549 - 130169397
Public Clones not available
Private Clones OST461466 (lexicon)
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027592
Sequence
GGGGCGCGCACTTACGGACTTACCTAGCCGACCAGGCACCGGGGCGCGCGACCCCTGACGAGGAGTGTCGTCGTCACGTGACACAGGGGCGTACTTTTCT

TGCCAAGCGCGCTCCGGTGCGCGTCCCCAGGGGGTGGCTGTCGGGCGTACGGGCTGGCTGGGTCCTCAGACCGGGGCCCGGATTAGCCGGTGGTTGCCGG

GGCCACGAGGCCAAAGAACCAGGAGGGCGGGGTCGGCTGTGGCACCGCGGCGACGACACACCGAGCGAGCGCCTGGGCCTGAAGGGGACGATGCTGTGGT

TCCAGGGCGCCATCCCGGCGGCCATCGCGTCTGCTAAGAGGAGCGGCGCGGTCTTCGTGGTGTTCGTGGCAG - UNI21514 - GGGATGATGAGCAA

TCTATACAAATGGCTGCAAGTTGGGAAGATGAAAAAGTGACACAAGCATCATCAAACAACTTTGTTGCTATTAAAATTGATACTAAAAG - UNI29388

 - TGAAGCCTGTCTGCAGTTTTCACAAATTT ATCCTGTAGTATGTGTTCCATCCAGTTTCTTTATAGGAGACAGTGGAATCCCTTTGGAAGTAATAGC

GGGGAGTGTTTCTGCAGATGAGCTTGTTACAAGAATTCATAAAGTCCAACAG ATGCACTCGTCAAAAGGTGAAGCATCAGTGACAAATGACAACCAGTC

AGAAAGTTCAGTATCTACCCCATCTGCCTCATTTGAACCTGATGTATGTGAAAATCCCGAGTCCAAAAATACAGAGCTTTGTGAGACACCAGCTACCTCT

GACACAAAGTCAGATACTGCAACAG - UNI9929 - GAGGAGAATGCACAGGTCATGACAGCCACTCTCAGGAGCCTCATGGATGTTCAAACCAGAGA

CCAGCCGAGGACCTCACCGTCAGAGTAGAAAG ACTAACAAAAAAACTTGAAGAAAGGAGAGAAGAGAAGCGGAAGGAAGAAGCACAG AGAGAGATTAA

GAAGGAAATTGAAAGGAGAAAAACTGGAAAGGAAATGTTGGATTATAAAAGAAAACAAGAAGAAGAATTAACAAAAAGAATGTTAGAAGAAAGAAGCAGA

GAGAAGGCAGAAGATAGAGCGGCTCGAGAGCGCATCAAGCAGCAGATTGCCCTG - UNI1095 - GATCGTGCAGAAAGAGCTGCTCGTTTTGCAAAG

ACAAAGGAAGCAGAAGCTGCCAAAGCTGCTGCCTTGCTGACCAAACAGGCAGGAACGGAAGTCAAGAGAGAGTCTACAGCACGAGACAGAAG - UNI11

609 - CACCATTGCAAGAATTCAGTTCCGGCTGCCTGATGGTTCTTCCTTTACAAACCAGTTTCCTTCTGATGCTCCTCTAGAAGAAGCGAGGCAGTTT

GCTGCACAG - UNI16430 - ACCGTGGGCAACACCTATGGCAATTTTTCATTAGCCACCATGTTTCCCAGAAGAGAGTTCACCAGAGAAGACTATAA

GAGGAGGCTGCTGGATCTGGAGCTCGCCCCCAGCGCCTCTGTGGTGCTGCTGCCA GCAGGACGGCCAGCCACATCCATTGTCCACTCTTCTAGTGGAGA

CATTTGGACATTACTGGGGACGGTGCTTTATCCATTCCTGGCCATATGGAGATTAATTAGCAATTTTTTATTTAGCAATCCTCCTCCTGCACAGACTTCA

GCAAGAGCCACATCCACAGAGCCTTCAAACTCTGCATCATCCAGCAAATCAGAGAAAAG GGAACCAGTCCGAAAAAGAATGCTGGAAAAACGAGGGGAA

GACTTTAAAAAAGAAGGGAAAATATACAGACTGAGGACTCAAGATGACGGTGAAGACGAGAACAACACTTGGAATGGAAACTCCACGCAGCAGATGTAGG

GTAGCGAGCAGTGCAGATTCTCACTGTTTCCTTAGGACTCCACTCAGCGAGACTGCTGCTGGAGAAGTGGGTCAGCTTTATGTTTTCAGACCGTGTATAG

TCTTTATTTCTGCTAAGAGGTTTTGAGTTAAGTTGTTTAACCTGAAAAAGTCAAACATGAAATAGCTGGATGCTAGGTCCTTGTGTAGGGTAACCAGCTG

TTGAGCCTAGAAGAATCCCAAGGCCACCCTGCCACCACCGCTCCTACTCAGACTCCACAGCCCCTAGCCCAGTGTTTCATTTAGGATACTTTTTGCTGCA

AGATTCTCAAGCCACACACAGTAACTGGTATGTCACTGAGTAGTCTGAGCCCCGAGCACCTCAGCGAGCTAATCAGGTGATAACTGATGTTTAGCGTTTC

TCTTTGCACTCATCAGCCTCAAAAACAAAACAAAAAAAAAAAATCTTGTAGTTTTTGATCTTACTTAAATATCAAATAAAAAAAGTTTCCAAAAAACCAG

AATGATCTTATTTTTGCTGTAAGCATCTTTGTTGTACAGGGCTGTATCGAGGTCACTTTTGTCTGACTTTTTCCTCCCAGTGCTGCCCTGAAGATGTCAG

CAAAATAACTGAGTACCTTTATTTAGAAAAATAAAATGTAGAAACTCTGTGTCCTAGGTTACTGATGCATCTGTTTTATAACCTGTTCTCATCGATGCCA

GGCAGATGAGAATGGCCAGTCTGCGGCTTAGATTGCTCACTAATATTCCTGCTGAAATCTCACATGCAGCAGTCACACTTGCCAGGCCAAAGTCCAGTAC

TGTAGGACTAGGGTAGAGAGGAGACACTTCACCCCCATTATTCCTGAAAGTTGTGATGTTTGAACCGTGGGGTATGTTTTGCTGTACTTCTGGTTTTAAA

ATGGAAAGTCAACCTGACCCTGCCTGTGTCAGACAGGAAGAACTCCTCTCCCCTGCGGAGTAACACGCGTGTTGCGTGTGAGCTGTGGTGCTGGCGGGAA

GCAGGGGGCAGCTAAAGTGCTGGAGTAACAGAACCTTCCTGAAAACATGCCTAGGAACTTTAAATATTTCATATTTTGACACAATAGCTTTTTCTAAGTA

ATGATCCTCATTGCAGAAGTTTAGCTATGAATAGTCCTAATATTAGTTAACTTAAAAACTGAAAACAACAAAATGCCTTCTGTGGATGTAATTCCTGTTG

AGAAATGGAACATACTAATCCAGCACATGTTTATTGAATGTCTGCTATGTTGGTGGAAAGAAGGCAGGAAGCATAGCTGTAGGCACAGGATGAGTTGAGC

TTTGTAAATTGTGTGTGTAGAGGGCAGCGTGCTAATGTATATGTAAAGAGAAGAACACGCTAATGATGTATGTCCTTGGAGTTCTCTTGCAGTCTTCTGC

ATTGATCACATTTGTTAACACTATTTAAAGAAGTTGTTTGCCAGGCATGGTGGCTCACACGTAAAATCCCAGCGCTTAGGAATCAGGTGCAGGAGTTTAA

GGGCCAGGCTGGTCTACATAGCAAGTTCAGGCCAGGGCTACAAGGTCAACAACAACAACAAAAATGCAAGCTTTTAAAACTTTGTAGGAACCATCTCATC

TAAGATCCAGTCATCTAAAAACACAGCAAGCTGGGCGTGGCATCTTGTTCCTGTACAGTACTTGGGAGATGGGGCAGGGCTCTCAAAGCTCAAGGTTATC

CTCAGGTCCAGGCTCAAGTCCAGCCTAGGCAGAGTGAGATCTGTCTCTGCAATAACGAGGCAATATATGAGTTTTAAGAAATACTTGTTAATGGTATGAA

TCCTGGAAAAACATTAATTACCTCAAGTCAATTTGTCTTGAAGAAAATCAAATACAAGTCTTAAAATGTCCATAGTTCATGTGTGAGTAACAGGATCACT

CTTCAACGTTATCTCTTTTAAAAGTACACATGGAGCTGGGCGTGGTGGCGCATGCCTTTAATCCCAGCACTAGGGAAGCAGAGGCAGGTGGATTTCTGAG

TTCGAGGCCAGCCTGGTCTACAAAGTGAGTTCCAGGACAGCCAGGGCTATTCAGAGAAACCCTGTCTCCAAAAAGCCAAAAGAAAGAAAAAAGTACACAT

GGTTGAAAAAAACCCCAGAATGTAAGAAAAGGGTGTCTCTGTCCCAGCGTCCTACCCCACTGCCACTACCCAGAGGTAACCTCTAGTCATAATTTCTAAT

GTCATTTTTAGAAAAATTTTATGCATATAATCAAATATGTAATCTTTATTTTTAAATAAATGGGATCATATTGTATGTACT
Translation
MLWFQGAIPAAIASAKRSGAVFVVFVAG - UNI21514 - GDDEQSIQMAASWEDEKVTQASSNNFVAIKIDTKS - UNI29388 - SEACLQFSQ

IY YPVVCVPSSFFIGDSGIPLEVIAGSVSADELVTRIHKVQQ MHSSKGEASVTNDNQSESSVSTPSASFEPDVCENPESKNTELCETPATSDTKSDTA

TG - UNI9929 - GGECTGHDSHSQEPHGCSNQRPAEDLTVRVER RLTKKLEERREEKRKEEAQ REIKKEIERRKTGKEMLDYKRKQEEELTKRML

EERSREKAEDRAARERIKQQIAL - UNI1095 - DRAERAARFAKTKEAEAAKAAALLTKQAGTEVKRESTARDRS - UNI11609 - STIARIQF

RLPDGSSFTNQFPSDAPLEEARQFAAQ - UNI16430 - TVGNTYGNFSLATMFPRREFTREDYKRRLLDLELAPSASVVLLP AGRPATSIVHSSSG

DIWTLLGTVLYPFLAIWRLISNFLFSNPPPAQTSARATSTEPSNSASSSKSEKR REPVRKRMLEKRGEDFKKEGKIYRLRTQDDGEDENNTWNGNSTQQ

M

For any suggestions or comments, please send an email to unitrap@crg.es