Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026361 (AC175246.2)
Chromosomal location
Chr 1: 145454630 - 145549814 (-)
Description
Parafibromin (Cell division cycle protein 73 homolog)(Hyperparathyroidism 2 protein homolog) [Source:UniProtKB/Swiss-Prot;Acc:Q8JZM7]
RefSeq_dna
NM_145991 
RefSeq_peptide
NP_666103.1 
UniGene
Mm.156727 
Uniprot/SWISSPROT
Q8JZM7 
Uniprot/SPTREMBL
B0QZG5 
Human Ortholog
ENSG00000134371 (CDC73)
Omim 145000 - HYPERPARATHYROIDISM 1  608266 - PARATHYROID CARCINOMA  
UniTrap UNI21686
Vector Insertion
Chr 1: 145546453 - 145549623
Public Clones not available
Private Clones OST321094 (lexicon) OST255982 (lexicon) OST168222 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24401
Vector Insertion
Chr 1: 145542593 - 145546346
Public Clones not available
Private Clones OST222079 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25706
Vector Insertion
Chr 1: 145538607 - 145542522
Public Clones not available
Private Clones OST169497 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8947
Vector Insertion
Chr 1: 145524986 - 145533052
Public Clones RRE190 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4004
Vector Insertion
Chr 1: 145518559 - 145524768
Public Clones AR0076 (sanger) AM0056 (sanger) AM0055 (sanger) A062C05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29
Vector Insertion
Chr 1: 145517199 - 145518459
Public Clones GC0274 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5736
Vector Insertion
Chr 1: 145514820 - 145517119
Public Clones CSI340 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2772
Vector Insertion
Chr 1: 145482220 - 145514754
Public Clones AK0020 (sanger) AR0291 (sanger) XR0007 (sanger) XP0567 (sanger)
RRR051 (baygenomics) RRK513 (baygenomics) IST15075D12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12739
Vector Insertion
Chr 1: 145475012 - 145482161
Public Clones W005C11 (ggtc) IST14708H10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3817
Vector Insertion
Chr 1: 145456642 - 145462432
Public Clones CA0127 (sanger) A050D07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12915
Vector Insertion
Chr 1: 145455688 - 145456499
Public Clones CMHD-GT_354B12-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000018337
Sequence
CGGCGACGGCGGGGCCCGGGGCCCGCGGCGGCGGCGGCGGCAGCAGCGAGGGGGGCGAAGATGGCGGACGTGCTCAGCGTCCTGCGACAGTACAACATCC

AGAAGAAGGAGATCGTGGTCAAGGGGGATGAAGTGATCTTCGGGGAGTTCTCCTGGCCCAAGAATGTGAAGACCAACTATGTAGTTTGGGG - UNI216

86 - GACCGGAAAGGAAGGCCAACCCAGAGAGTACTACACATTGGATTCTATCTTATTTCTCCTTAATAATGTGCACCTTTCGCATCCTGTTTATGTCC

GGCGTGCAGCT - UNI24401 - ACTGAAAATATTCCTGTGGTTAGAAGACCCGACCGAAAAGATCTACTTGGATATCTCAATGGGGAAGCAT - UN

I25706 - CAACATCAGCAAGCATAGACAGGAGTGCCCCCTTGGAAATAGGTCTTCAGCGGTCTACTCAAG TCAAAAGAGCTGCAGATGAAGTTTTAG

CAGAAGCAAAGAAACCACGGATTGAG GATGAAGAGTGTGTGCGCCTTGATAAAGAGAGATTGGCAGCTCGTTTGGAAGGCCATAAAGAAGGGATCGTGC

AGACTGAGCAGATTAG - UNI8947 - GTCTTTGTCTGAAGCCATGTCAGTGGAAAAAATTGCTGCAATCAAAGCCAAAATTATGGCTAAGAAAAGAT

CTACTATCAAGACTGATCTAGATGATGATATAACTGCCCTTAAACAGAGGAGTTTTGTGGATGCTGAGGTAGATGTGACCAGAGATATTGTCAGCAGAGA

GAGAGTGTGGAGGACAAGAACAACTATTTTACAGAGCACAGGAAAG - UNI4004 - AATTTTTCAAAGAATATTTTTGCAATTCTTCAATCTGTAAA

AGCCAGAGAAGAAGGTCGTGCCCCTGAACAACGGCCAGCTCCAAATGCAGCCCCCGTG - UNI29 - GATCCTACATTGCGTACAAAACAGCCTATTC

CAGCTGCTTACAACAGATATGACCAAGAAAGATTCAAAGGCAAAGAAG - UNI5736 - AAACGGAAGGCTTTAAGATCGATACTATGGGCACCTACC

ATGGCATGACACTGAAATCTGTAACG - UNI2772 - GAAGGTGCATCTGCTCGTAAGACTCAAACTCCTGCAGCCCAGCCTGTACCTAGACCAG - 

UNI12739 - TGTCTCAAGCCAGACCCCCCCCAAATCAGAAGAAAG GGTCACGGACACCCATTATTATTATTCCTGCAGCTACCACTTCTTTAATAAC

TATGCTTAATGCAAAAGACCTTCTACAGGATCTGAA ATTTGTCCCATCAGATGAGAAGAAGAAACAGGGTTGTCAACGAGAAAATGAAACACTAATACA

GAGAAGAAAAGACCAGATGCAACCAGGGGGCACAGCAATTAGTGTCACAGTACCTTACAGAGTAGTAGACCAGCCCCTGAAACTTATGCCTCAAGACTG 

GGATCGAGTTGTGGCTGTTTTTGTACAAGGTCCTGCTTGGCAATTCAAAGGTTGGCCATGGCTTCTCCCTGATGGATCACCAGTTGACATATTTGCGAAA

A - UNI3817 - TTAAAGCCTTCCATCTCAAGTATGATGAAGTTCGTCTAGATCCAAATGTTCAAAAGTGGGATGTAACAGTATTAGAACTCAGCTAT

CATAAACGTCACTTGGATAGACCAGTTTTCTTACGTTTCTGGGAAACATTGGATAG - UNI12915 - ATACATGGTAAAGCATAAATCCCACTTGAG

ATTCTGAATCATTTAACCCCTCCTTTTCTGAAACCTTGGATTACGAAGCATGGATACAGCTTGATCTACAGACTGAAAGCAAGCTTATGAATTCATCAAG

AACTTGCAAATGAAGAAGGACACAGAGTAGTCTTTTATAAGACCTTGTTTGATGCTGTGTGCTTCAAAGGGGCAATGCCTCCCATCCATACAAGCAAACT

TTTTTGGCTTACAAATATTTTTTTAATATTAGCCTTCTAGTCTGTAATGGAAATTGTATATTTTGATAGAAGTTTTTTCTCTATTGGTTAAATTAGCATT

ACTTAAAATTTGTTCTTTAGAAATAAATACAGGTTATAAATGTGTGTATATTTAGGAGTTATTAGGCTCTTCAAGCCATCTTGCTTCTGATTTTTCATTG

CTCTGTGGTTCCTTTTACTGGAAAATACTGTCATGATGGTATTAAATTTTAGACTATAGAACTTCAAAACCCTATCAAAGGGAAGTAACTATGAAATCAG

TTGAAAGTCAGCCTGTGTGTATCCGATGTCTATACTAACTCATGTTTAAAAAGGAATAATGAAAAATCAAGAACAAGTCTTCAGTTTCAGTTGAACTGTT

CAGCCTTTTCAAGATTTCTTTTGTAAATGAATACATTTAATGAATGTACATTCTCTTTGTTGACTTTGATGATTTTAAACTTAAAGTGATATATTTCTAT

CTGGAATATGTTTCCACTTGAAAAGAAATCTTAAAAAACAAAGATTAAAGTGAAATAGACTGTAGTGATTTTTACTTGGGAAGCTACAGTATGATTTGGG

GGGATGAGTGTGTGTCAACATAGTTACAGTGTAACTTGAACCTCCTCTAAGTCTGACTATGATTCTTATTTTATATGCGATAAGATTTTGAGTCTTCTAT

TTGTACACATGTCAACTTGGGACTTCTTATCTTCCATTATCCCTAAATAATGATAAATTCCCAGGCACCAAAGAACACATTTGCTTACGTGTCTGAAAAT

GAAACAAGATAAAAACACTGGTATTTTT
Translation
MADVLSVLRQYNIQKKEIVVKGDEVIFGEFSWPKNVKTNYVVWG - UNI21686 - GTGKEGQPREYYTLDSILFLLNNVHLSHPVYVRRAA - UNI

24401 - TENIPVVRRPDRKDLLGYLNGEAS - UNI25706 - STSASIDRSAPLEIGLQRSTQV VKRAADEVLAEAKKPRIE DEECVRLDKERL

AARLEGHKEGIVQTEQIR - UNI8947 - RSLSEAMSVEKIAAIKAKIMAKKRSTIKTDLDDDITALKQRSFVDAEVDVTRDIVSRERVWRTRTTILQ

STGK - UNI4004 - NFSKNIFAILQSVKAREEGRAPEQRPAPNAAPV - UNI29 - DPTLRTKQPIPAAYNRYDQERFKGKEE - UNI5736 -

 ETEGFKIDTMGTYHGMTLKSVT - UNI2772 - EGASARKTQTPAAQPVPRPV - UNI12739 - VSQARPPPNQKKG GSRTPIIIIPAATTSL

ITMLNAKDLLQDLK KFVPSDEKKKQGCQRENETLIQRRKDQMQPGGTAISVTVPYRVVDQPLKLMPQDW WDRVVAVFVQGPAWQFKGWPWLLPDGSPV

DIFAKI - UNI3817 - IKAFHLKYDEVRLDPNVQKWDVTVLELSYHKRHLDRPVFLRFWETLDR - UNI12915 - RYMVKHKSHLRF

For any suggestions or comments, please send an email to unitrap@crg.es