Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026377 (Mki67ip)
Chromosomal location
Chr 1: 120218449 - 120230166 (+)
Description
Mki67 (FHA domain) interacting nucleolar phosphoprotein Gene [Source:MGI Symbol;Acc:MGI:1915199]
RefSeq_dna
NM_026472 
RefSeq_peptide
NP_080748.2 
UniGene
Mm.397262 Mm.280311 
MGI
MGI:1915199 
Uniprot/SWISSPROT
Q91VE6 
Uniprot/SPTREMBL
Q8BMY3 
Human Ortholog
ENSG00000155438 (MKI67IP)
Omim not available
UniTrap UNI1674
Vector Insertion
Chr 1: 120220303 - 120224201
Public Clones AG0036 (sanger) AF0092 (sanger) CH0035 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112688
Sequence
GACTTGTTCGGGTTCTCCAGCATGGCTGGGTTAGCAGGCCCCGCGAAGCCGAGTCTGGCATTGAACCCGCAGGAAGACTCGCAGTTTGAGAAGGCTCTGA

CGCAGATCCAAGGGCGCACGAAGAAG - UNI1674 - ACTGGAAACAGCAAAGGCTATGCCTTTGTGGAGTTTGAGTCTGAGGATGTTGCCAAGATAG

TTGCAGAAACAATGGATAACTACCTTTTTGGTGAAAGACTTCTATCAT GTAAATTTATGCCACGAAAAAAAGTCCATAAAGACCTTTTCAGCCAGAGGA

ATGCTCTGTTTCACCGGCCATCATTCCCAGCAGTGAAGCGCTATAATCGGAAACGAGGACATTTGCAGATGTTGAAGATGGAGTATAGGTTTAAGAAGAA

GGAAAAATTACTCCGGAAGAAACTAGCTGCAAAGGGGATTGATTATAGTTTTCCCTCACTG GTCCTACCTAAGCCAAAGAACATTGCTGTCGCTCATAG

AGATTCTGAGGGTAACCAG GTTTTACCTGACCAAAAAGAAGGGCTTTCGGGTGAACCTAGGAGAAAGGAGAAGATGATGAAAGAGGACATTTCCAATAA

CATTCCTAAGAAGCGTAAGAGGTCTAGGAGGAAGAAGTCGTCTGTGGACAGCCAG GGTCCCACACCAGTTTGTACACCGACGTTTTTGGAGAGGCGAAA

ATCGCAGGTGATGGAAGTCGGTGGCGATAAAGATGATGAAATCATTCTCAAGCTGCCTGTGCCCCCAGTGAAAGAAGACACACAAAAGACCCCAACATCT

GCAAGCCCTGGGGGAAAAAGACCGAGAAAAAGGAAGAGCAAGCAGTGATCCCGCCAGCGTTCTGTGCATAGTTCTAGGCAGATGTGTTGTTATAAGGGAC

TACTATATTTTACTAAGTGCAGTGACTTGCAAGCACAGACAAGACTGTTGGAGGAAGAATACATGTTTGGTTTTCCAGTGAGGAAAGCCACTGGGAACCT

GACTGTGCCCTTTCCTGTCCTGAATTTGTCTTCAGGCTTCATCGGTCCCTCAGTTTTACTATCCTTATGAAACTCAGGCTTAACTACCACCAAACAACCG

ATTGGTGCTGTTTGGACGGTGTGTAGTTGTGTATCTAAACCCCTCCAAAATATGTCAGGCTTCAGCCTCAGACATCTGAAACTGGAAATGAAATCCAGAG

AGTGAGAGGGCAGTTCTGGTTTAGATTTCCACATGTGTCCAGGAGCTGAGGAGGAGTCCGAAATGACCCACAGTTACTGCAGCTAAGCTAGTGTGTAGGT

GTCACAAATCAGTTTCAGCAGTTGTATTCAAGATTCACTGACCAGACTTTTCTACAGTTTATTTGTGTACAAGAGAACCTAAGAACTTTGTGGGGAAGTA

AGAAATGTCACCATCTCCTGTTGTAAGTTTCTGTACCCTTTCTATGCTTTTGTTTTACTAATTTGGGTTTCTTGAATATAACTGTCAATCTCCTTG
Translation
MAGLAGPAKPSLALNPQEDSQFEKALTQIQGRTKK - UNI1674 - TGNSKGYAFVEFESEDVAKIVAETMDNYLFGERLLSC CKFMPRKKVHKDLF

SQRNALFHRPSFPAVKRYNRKRGHLQMLKMEYRFKKKEKLLRKKLAAKGIDYSFPSL VLPKPKNIAVAHRDSEGNQ VLPDQKEGLSGEPRRKEKMMKE

DISNNIPKKRKRSRRKKSSVDSQ GPTPVCTPTFLERRKSQVMEVGGDKDDEIILKLPVPPVKEDTQKTPTSASPGGKRPRKRKSKQ
Transcript ENSMUST00000027626
Sequence
GACTTGTTCGGGTTCTCCAGCATGGCTGGGTTAGCAGGCCCCGCGAAGCCGAGTCTGGCATTGAACCCGCAGGAAGACTCGCAGTTTGAGAAGGCTCTGA

CGCAGATCCAAGGGCGCACGAAGAAG CCTCAGCAAAAGAAGAAAGAAAAACTTAACCGTGGAGTAGTTTATCTGGGCCACCTACCTTCAACACTTTCTG

AAAGCCACATCTATAACTACTGTGCCCAGTTTGGCGACATTAGCAGATTCAGATTGTCTAGAAGTAAGCGG - UNI1674 - ACTGGAAACAGCAAAG

GCTATGCCTTTGTGGAGTTTGAGTCTGAGGATGTTGCCAAGATAGTTGCAGAAACAATGGATAACTACCTTTTTGGTGAAAGACTTCTATCAT GTAAAT

TTATGCCACGAAAAAAAGTCCATAAAGACCTTTTCAGCCAGAGGAATGCTCTGTTTCACCGGCCATCATTCCCAGCAGTGAAGCGCTATAATCGGAAACG

AGGACATTTGCAGATGTTGAAGATGGAGTATAGGTTTAAGAAGAAGGAAAAATTACTCCGGAAGAAACTAGCTGCAAAGGGGATTGATTATAGTTTTCCC

TCACTG GTCCTACCTAAGCCAAAGAACATTGCTGTCGCTCATAGAGATTCTGAGGGTAACCAG GTTTTACCTGACCAAAAAGAAGGGCTTTCGGGTGA

ACCTAGGAGAAAGGAGAAGATGATGAAAGAGGACATTTCCAATAACATTCCTAAGAAGCGTAAGAGGTCTAGGAGGAAGAAGTCGTCTGTGGACAGCCAG

 GGTCCCACACCAGTTTGTACACCGACGTTTTTGGAGAGGCGAAAATCGCAGGTGATGGAAGTCGGTGGCGATAAAGATGATGAAATCATTCTCAAGCTG

CCTGTGCCCCCAGTGAAAGAAGACACACAAAAGACCCCAACATCTGCAAGCCCTGGGGGAAAAAGACCGAGAAAAAGGAAGAGCAAGCAGTGATCCCGCC

AGCGTTCTGTGCATAGTTCTAGGCAGATGTGTTGTTATAAGGGACTACTATATTTTACTAAGTGCAGTGACTTGCAAGCACAGACAAGACTGTTGGAGGA

AGAATACATGTTTGGTTTTCCAGTGAGGAAAGCCACTGGGAACCTGACTGTGCCCTTTCCTGTCCTGAATTTGTCTTCAGGCTTCATCGGTCCCTCAGTT

TTACTATCCTTATGAAACTCAGGCTTAACTACCACCAAACAACCGATTGGTGCTGTTTGGACGGTGTGTAGTTGTGTATCTAAACCCCTCCAAAATATGT

CAGGCTTCAGCCTCAGACATCTGAAACTGGAAATGAAATCCAGAGAGTGAGAGGGCAGTTCTGGTTTAGATTTCCACATGTGTCCAGGAGCTGAGGAGGA

GTCCGAAATGACCCACAGTTACTGCAGCTAAGCTAGTGTGTAGGTGTCACAAATCAGTTTCAGCAGTTGTATTCAAGATTCACTGACCAGACTTTTCTAC

AGTTTATTTGTGTACAAGAGAACCTAAGAACTTTGTGGGGAAGTAAGAAATGTCACCATCTCCTGTTGTAAGTTTCTGTACCCTTTCTATGCTTTTGTTT

TACTAATTTGGGTTTCTTGAATATAACTGTCAATCTCCTTG
Translation
MAGLAGPAKPSLALNPQEDSQFEKALTQIQGRTKK PQQKKKEKLNRGVVYLGHLPSTLSESHIYNYCAQFGDISRFRLSRSKR - UNI1674 - TGN

SKGYAFVEFESEDVAKIVAETMDNYLFGERLLSC CKFMPRKKVHKDLFSQRNALFHRPSFPAVKRYNRKRGHLQMLKMEYRFKKKEKLLRKKLAAKGID

YSFPSL VLPKPKNIAVAHRDSEGNQ VLPDQKEGLSGEPRRKEKMMKEDISNNIPKKRKRSRRKKSSVDSQ GPTPVCTPTFLERRKSQVMEVGGDKDD

EIILKLPVPPVKEDTQKTPTSASPGGKRPRKRKSKQ

For any suggestions or comments, please send an email to unitrap@crg.es