Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026383 (Epb4.1l5)
Chromosomal location
Chr 1: 121444708 - 121545513 (-)
Description
erythrocyte protein band 4.1-like 5 Gene [Source:MGI Symbol;Acc:MGI:103006]
RefSeq_dna
NM_145506 
RefSeq_peptide
NP_001106887.1 NP_663481.2 
UniGene
Mm.253156 
MGI
MGI:103006 
Uniprot/SWISSPROT
Q8BGS1 
Uniprot/SPTREMBL
Q8BT29 
Human Ortholog
ENSG00000115109 (EPB41L5)
Omim not available
UniTrap UNI24432
Vector Insertion
Chr 1: 121539236 - 121545361
Public Clones D078F05 (ggtc) (ggtc) IST14683E1 (tigm) IST15051H6 (tigm) IST11587A8 (tigm)
Private Clones OST220758 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4537
Vector Insertion
Chr 1: 121530227 - 121539053
Public Clones AS0008 (sanger) (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23755
Vector Insertion
Chr 1: 121520546 - 121530121
Public Clones not available
Private Clones OST245909 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4405
Vector Insertion
Chr 1: 121516797 - 121517251
Public Clones AE0088 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1135
Vector Insertion
Chr 1: 121505864 - 121511922
Public Clones CC0064 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10036
Vector Insertion
Chr 1: 121501833 - 121504563
Public Clones XC282 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9151
Vector Insertion
Chr 1: 121451720 - 121464372
Public Clones RRE008 (baygenomics) RRE146 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027632
Sequence
AGCGCAGGGTGGGCTCGCGCCTTGCGCCGCCATTTCTCGGTGTCTCTGGAGACCCGTCCTCTCCTCTAGCCGGCTGGGCATCTCTCTCCGAGGGTCGCGC

GTCCCAGTCGCAGTGGTCTCCGTCGCTTCACGGTGTTCACCCCCGAGTACAG - UNI24432 - AAATGCTGAGCTTCCTGAGACGAACGCTTGGCCG

CAGGTCTATGCGCAAGCATGCTGAAAAGGAGCGGCTCCGAGAGGCACAGCGTGCGGCCACACACATTCCTGCCGCTGGGGATGCCAAGTCCATCATCACA

TGCAGGGTGTCCCTTCTGGACGGTACAGATGTCAGTGTGGACTTGCCG - UNI4537 - AAAAAAGCCAAAGGACAGGAGCTGTTTGACCAAATCATG

TATCACCTGGACTTGATTGAAAGTGACTATTTTGGTTTGAGATTCATGGATTCAGCCCAAGTAGCC - UNI23755 - CATTGGTTGGATGGTACAAA

AAGCATCAAAAAGCAAGTAAAAA TTGGTTCACCCTATTGTCTTCATCTTCGAGTTAAGTTTTATTCCTCGGAACCAAATAATCTTCGTGAGGAGCTAAC

CCG GTATTTATTTGTTCTTCAGCTAAAACAAGATATTCTCAGTGGGAA - UNI4405 - GTTAGAGTGTCCCTTTGATACAGCAGTTCAGTTGGCAG

CTTATAATCTGCAAG CTGAACTTGGCGACTATGATCTTGCTGAACATAGTCCTGAACTGGTCTCTGAGTTCAGGTTTGTGCCCATCCAGACTGAAGAGA

TGGAACTGGCTATTTTTGAGAAATGGAAGGAATACAG AGGTCAGACACCAGCACAAGCAGAAACCAATTACCTGAATAAAGCCAAATGGCTAGAAATGT

ATGGTGTTGATATGCACGTGGTCAAG GCTAGAGATGGCAATGACTATAGTTTGGGACTGACTCCAACAGGAGTCCTTGTTTTTGAAGGAGAGACCAAAA

TTGGCTTGTTTTTCTG GCCCAAGATAACCAGATTGGATTTTAAGAAGAATAAGTTAACTCTAGTGGTTGTGGAAGATGATGATCAG - UNI1135 - 

GGCAAAGAACAAGAGCATACCTTTGTCTTTAGATTGGATCACCCTAAAGCCTGCAAACACTTATGGAAATGTGCTGTGGAGCACCATGCCTTCTTCCGCC

TCCGAGGACCTGTCCAAAAGAGTTCCCATCGATCAGGATTCATTCGACTAGGATCCCGATTTAGATACAG TGGAAAAACAGAATATCAGACCACAAAAA

CTAATAAAGCAAGAAGATCAACCTCCTTTGAAAGAAGGCCTAGCAAGCGGTATTCCCGACGGACGCTGCAAATGAAAG - UNI10036 - CCAGCACA

ACACAACCTGAAGATCTTGG TGTTCTTAATGCTTCCGCTCAGAAAAGTGACTCCCAACAG GCTTGGGGTGTGATGTCTCCTGTGCCTGTCACTTCTTC

CTCATCCTGTGGCGCTGTGCAGGTGGAGATAGAGAATCTCCCACAGACCTCTGCGACAGAGCAGCACGACAGGAAATG GCTCTCTGCTACCAGTGACCG

CTGCCAACGTGGTGGAAACCAGTGGAACCCAAGGGCCTTGCCCCCACCCCAGACTGCATATAGAAACTACACTGACTTTGTACATGAGCATAATGTGAAG

AATGCAGGAGCCCATCATGACGCTCAGTTATCTGGCCGTGCAGCCATGACCGAGATATGA
Translation
 - UNI24432 - MLSFLRRTLGRRSMRKHAEKERLREAQRAATHIPAAGDAKSIITCRVSLLDGTDVSVDLP - UNI4537 - KKAKGQELFDQIM

YHLDLIESDYFGLRFMDSAQVA - UNI23755 - HWLDGTKSIKKQVKI IGSPYCLHLRVKFYSSEPNNLREELTR RYLFVLQLKQDILSGK - U

NI4405 - KLECPFDTAVQLAAYNLQA AELGDYDLAEHSPELVSEFRFVPIQTEEMELAIFEKWKEYR RGQTPAQAETNYLNKAKWLEMYGVDMHVV

K ARDGNDYSLGLTPTGVLVFEGETKIGLFFW WPKITRLDFKKNKLTLVVVEDDDQ - UNI1135 - GKEQEHTFVFRLDHPKACKHLWKCAVEHHA

FFRLRGPVQKSSHRSGFIRLGSRFRYS SGKTEYQTTKTNKARRSTSFERRPSKRYSRRTLQMKA - UNI10036 - ASTTQPEDLG GVLNASAQKS

DSQQ AWGVMSPVPVTSSSSCGAVQVEIENLPQTSATEQHDRKW WLSATSDRCQRGGNQWNPRALPPPQTAYRNYTDFVHEHNVKNAGAHHDAQLSGRA

AMTEI
Transcript ENSMUST00000052404
Sequence
AGCGCAGGGTGGGCTCGCGCCTTGCGCCGCCATTTCTCGGTGTCTCTGGAGACCCGTCCTCTCCTCTAGCCGGCTGGGCATCTCTCTCCGAGGGTCGCGC

GTCCCAGTCGCAGTGGTCTCCGTCGCTTCACGGTGTTCACCCCCGAGTACAG - UNI24432 - AAATGCTGAGCTTCCTGAGACGAACGCTTGGCCG

CAGGTCTATGCGCAAGCATGCTGAAAAGGAGCGGCTCCGAGAGGCACAGCGTGCGGCCACACACATTCCTGCCGCTGGGGATGCCAAGTCCATCATCACA

TGCAGGGTGTCCCTTCTGGACGGTACAGATGTCAGTGTGGACTTGCCG - UNI4537 - AAAAAAGCCAAAGGACAGGAGCTGTTTGACCAAATCATG

TATCACCTGGACTTGATTGAAAGTGACTATTTTGGTTTGAGATTCATGGATTCAGCCCAAGTAGCC - UNI23755 - CATTGGTTGGATGGTACAAA

AAGCATCAAAAAGCAAGTAAAAA TTGGTTCACCCTATTGTCTTCATCTTCGAGTTAAGTTTTATTCCTCGGAACCAAATAATCTTCGTGAGGAGCTAAC

CCG GTATTTATTTGTTCTTCAGCTAAAACAAGATATTCTCAGTGGGAA - UNI4405 - GTTAGAGTGTCCCTTTGATACAGCAGTTCAGTTGGCAG

CTTATAATCTGCAAG CTGAACTTGGCGACTATGATCTTGCTGAACATAGTCCTGAACTGGTCTCTGAGTTCAGGTTTGTGCCCATCCAGACTGAAGAGA

TGGAACTGGCTATTTTTGAGAAATGGAAGGAATACAG AGGTCAGACACCAGCACAAGCAGAAACCAATTACCTGAATAAAGCCAAATGGCTAGAAATGT

ATGGTGTTGATATGCACGTGGTCAAG GCTAGAGATGGCAATGACTATAGTTTGGGACTGACTCCAACAGGAGTCCTTGTTTTTGAAGGAGAGACCAAAA

TTGGCTTGTTTTTCTG GCCCAAGATAACCAGATTGGATTTTAAGAAGAATAAGTTAACTCTAGTGGTTGTGGAAGATGATGATCAG - UNI1135 - 

GGCAAAGAACAAGAGCATACCTTTGTCTTTAGATTGGATCACCCTAAAGCCTGCAAACACTTATGGAAATGTGCTGTGGAGCACCATGCCTTCTTCCGCC

TCCGAGGACCTGTCCAAAAGAGTTCCCATCGATCAGGATTCATTCGACTAGGATCCCGATTTAGATACAG TGGAAAAACAGAATATCAGACCACAAAAA

CTAATAAAGCAAGAAGATCAACCTCCTTTGAAAGAAGGCCTAGCAAGCGGTATTCCCGACGGACGCTGCAAATGAAAG - UNI10036 - CCAGCACA

ACACAACCTGAAGATCTTGG TGTTCTTAATGCTTCCGCTCAGAAAAGTGACTCCCAACAG GCTTGGGGTGTGATGTCTCCTGTGCCTGTCACTTCTTC

CTCATCCTGTGGCGCTGTGCAGGTGGAGATAGAGAATCTCCCACAGACCTCTGCGACAGAGCAGCACGACAGGAAATG CTTGCCCCTAAGCGTTGATTT

GCTCAACAGCCCAGACTTACTAGAAACAACCATTGGTGATGTAACAAGGACGTCAGAGACTTCGGCACCATTCCCAGCACCAGATACCATTAATGTTGCC

ACCAGGTCAAATGAATTAGAGGAATTCAAAGCTGAATGTGAGA CATTAAAGGATGACACAGAGAAGCTTAAACAGCTTGAAACAGAGCAGACTATCTTG

CCATCTCTTCGACCTACCATTGACATTAATGTCAACAGCCAG GAAGAAGTGGTAAAGTTGACTGAGAAATGTCTTAATAATGCCATTGAGAACCCAGCA

TTGAATGCAGTAAAGGTTCCTCCTGACTTCAAGAGTAATATTTTGAAAGCTCAAGTAGAAGCTGTGCATAAG GTTACAAGAGAAGATAGTTTATTAACT

CATAAAAATGCCAGCGTTCAGGATGCTGCCACAAACAG - UNI9151 - TACTGCATTCAATGAAAATGATGTGCCCGTCTGTAAAGATTCCCTCACT

CCGGTGCATGGCACAGCTGCAGACAGTGCCTCTGTACTAAAG GATGCTACTGATGAACTGGACGCCTTACTTCTTTCTCTGACAGAGAATCTGATGGAC

CACACAGTAACACCTCAG GTGTCTTCACCATCCATGATCACACCCCGGTGGATTATTCCA CAGAGTGCTACCATCTCCAATGGGCTTGCAGGATATGG

AGCATCTTTGGCAGGGACAGATGAATGTAGTCAGAAAGATGGATTCTCACTGATTTCCCCCCCAGCACCATTCTTGGTAGATGCTGTGACCAG CTCTGC

CCCTCCCTTGCCTGAAGACTCAACCTTGAAGCAGAAGTGCTTGCTGACTACTGAGCTCTGAGGGCTGCTGCTCCCCACCTGTAACTGGATTGCCCCACAC

CGTCCCCAGTCAGCCCTGGATCCATGTGTCCTTTACTTGGGGAAAACCTTCTACCAGGATTTGACTTCAACTCCATAATGAGAGTAGCTACATTTTCCGT

CCAACTGGAAGTCTACCCCATATAACTGCTTAACTGAAGATACCTCCTCCTCCTCCTGTAACTGTATTTGCATTGCCAATTCCTGAAGCAATGAAGGTAA

CTAGTTTCCTGCAAACTGATGGCTCCACCTAGCGGTTGCAACTGTTTATAGCTTAGAGCAAGGCTTGCTGTCCAGAGCCTTTCATTGCTGTTTCCCTGGG

TTGTCAGGGGAGCACACCTGAACTGAGAGCCTGCTGGAGAAATGCGTGGCACTTTCCTGTGCATTCCCTGGAAATGAGAATTAGAAAATGGATGGAAACA

CTATGTGGCTAGATCCCAGGCCAGCTCCTGCACAGTTGCTAGGATTCTTGGAGAAGCTGAGAACATAGAGGGGTGAGGCTGTCACCCAGACTTTGAATTC

TGAGCAGTAATGACCTTACATCAAAGGTAAATGTTATCTTTGGATAACTAGAGAGAGGTTCAGTCTCTAGGCGTGAACTCCTCAGACCACTTTCCTATTG

GAAGCACCTAAACCCCTCGCCTGTTTTTAACTTTGCAGCCTGGGAGGGAGCAAGTGTCAGCTCAGAGACCCGAGGCCTGTGCTCTTCTTCCTGAGCCAGT

GGGGAATTCGGCCCTACTAGGCTTACCAGTTGGAAAGTCAGGACCTGTTTAGGCATAGCCTCCAGTTCCTTTCGGTGTACACTGCGTGAGCTTACAGCTT

CCAAGCTAAAAGGAAAAGAAAAATACTTGGCAGAAATGGGGAATGCCTGTGAGAGGGCTTGGGTTCTTGAATGGGTATAACAAATGAAGTCAGTTTACAT

AGGGGTTTTGTATTCATTTTAAAGTCCTCTAGAATCCCCCATTCCTTTAGCCTGTACCC
Translation
 - UNI24432 - MLSFLRRTLGRRSMRKHAEKERLREAQRAATHIPAAGDAKSIITCRVSLLDGTDVSVDLP - UNI4537 - KKAKGQELFDQIM

YHLDLIESDYFGLRFMDSAQVA - UNI23755 - HWLDGTKSIKKQVKI IGSPYCLHLRVKFYSSEPNNLREELTR RYLFVLQLKQDILSGK - U

NI4405 - KLECPFDTAVQLAAYNLQA AELGDYDLAEHSPELVSEFRFVPIQTEEMELAIFEKWKEYR RGQTPAQAETNYLNKAKWLEMYGVDMHVV

K ARDGNDYSLGLTPTGVLVFEGETKIGLFFW WPKITRLDFKKNKLTLVVVEDDDQ - UNI1135 - GKEQEHTFVFRLDHPKACKHLWKCAVEHHA

FFRLRGPVQKSSHRSGFIRLGSRFRYS SGKTEYQTTKTNKARRSTSFERRPSKRYSRRTLQMKA - UNI10036 - ASTTQPEDLG GVLNASAQKS

DSQQ AWGVMSPVPVTSSSSCGAVQVEIENLPQTSATEQHDRKC CLPLSVDLLNSPDLLETTIGDVTRTSETSAPFPAPDTINVATRSNELEEFKAECE

T TLKDDTEKLKQLETEQTILPSLRPTIDINVNSQ EEVVKLTEKCLNNAIENPALNAVKVPPDFKSNILKAQVEAVHK VTREDSLLTHKNASVQDAAT

NS - UNI9151 - STAFNENDVPVCKDSLTPVHGTAADSASVLK DATDELDALLLSLTENLMDHTVTPQ VSSPSMITPRWIIP QSATISNGLAGY

GASLAGTDECSQKDGFSLISPPAPFLVDAVTS SSAPPLPEDSTLKQKCLLTTEL

For any suggestions or comments, please send an email to unitrap@crg.es