Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026387 (Sctr)
Chromosomal location
Chr 1: 121903555 - 121959859 (+)
Description
secretin receptor Gene [Source:MGI Symbol;Acc:MGI:2441720]
Human Ortholog
not available
Omim not available
UniTrap UNI36726
Vector Insertion
Chr 1: 121933016 - 121940027
Public Clones IST14570E12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000097613
Sequence
ATGCTCAGCACCATGAGCCCCCGGCTGTCACTGCTTCTGCTGTGGCTGCTGCTGCTCATCAATGCAGCGCACCCT GTTGGAGCTCTGCCCAGATTGTGT

GATGTGCGGCGTGTGCTGCTCGAGGAACGGGCCGAGTGCCTGCGGGAACTCTCCGAAGAGAAGAAGGCGCTGGGCCCGAAGACAGCATCAG CCATCGTA

TTCTCACCGTCTGCTCCTTCGTACACGGTTCATCAAG GCTGTGAGAGGTTTTGGGACAACATGAGCTGCTGGCCCTCCTCGGCACTGGCACAGACAGTG

GAAGTGCCATGTCCGAAGTTCCTGAGGATGTTCTCTGGCAGAAATG GGTCTCTGTTCCGGAACTGCACAAAGGATGGCTGGTCAGAAACCTTCCCCAGG

CCTGACCTGGCCTGTGGGGTCAACATGAATGGCTCCTTTAATGAGAGACGG - UNI36726 - CATGCATACCTGCTGAAGCTCAAGGTCATGTACAC

TGTAGGCTACAGTTCCTCCTTGGCCATGCTCCTGGTCGCCCTCAGCATCCTGTGCTCTTTCCG GAGGCTGCACTGCACTCGCAACTACATCCACATGCA

CCTGTTTGTGTCCTTCATCCTTCGCGCCCTGTCCAACTTCATCAAGGACGCCGTACTCTTCCCCGCAGATGACGTCACCTACTGTGATGCCCACAGG GC

AGGCTGCAAGCTGGTCATGATCTTCTTCCAGTACTGCATCATGGCCAACTACGCGTGGCTGCTGGTGGAGGGCCTCTATCTTCACACGCTCCTGGCCATC

TCCTTCTTCTCAGAAAGGAAGTGCCTGCAGGCATTTGTGCTCTTCGGATGGG GTTCTCCAGCCATTTTTGTTGCTTTGTGGGCTGTCACCAGACACTTT

CTGGAGGACTTTGG ATGCTGGGACATCAACTCCAACGCTTCCATCTGGTGGGTCATT AGGGCCTGTGATTCTGTCCATCGTG ATCAATTTCATCTTT

TTCATAAACATTCTAAGAATCCTGATGAGAAAACTTAG
Translation
MLSTMSPRLSLLLLWLLLLINAAHP VGALPRLCDVRRVLLEERAECLRELSEEKKALGPKTASA AIVFSPSAPSYTVHQG GCERFWDNMSCWPSSAL

AQTVEVPCPKFLRMFSGRNG GSLFRNCTKDGWSETFPRPDLACGVNMNGSFNERR - UNI36726 - HAYLLKLKVMYTVGYSSSLAMLLVALSILC

SFR RRLHCTRNYIHMHLFVSFILRALSNFIKDAVLFPADDVTYCDAHR AGCKLVMIFFQYCIMANYAWLLVEGLYLHTLLAISFFSERKCLQAFVLFG

WG GSPAIFVALWAVTRHFLEDFG GCWDINSNASIWWVI RACDSVHRD DQFHLFHKHSKNPDEKT
Transcript ENSMUST00000072886
Sequence
TCCCTGCTATTCCCTGCAGGGTGGAGTCGCGAGCTGTCGTCCAGTCTTTATCAATAGGCACTGCAGGTTAGTTAACAGTCTTGCCACCTCCTTCAGGGAG

CAGCAGTCCCTAGCCTGGCTGTGGGTCTGGTCGGATTGGGTAGGTCCAGCCATGGCTTCTCTGGGCTTGGGGGTCGCCCAGGGTCCTGGACGACATGCAG

GACGCTGAGCTGGACACAGAGACGGACACCCAGCTCCTGAAGAGGCCAGAGCACAAAGGGGATCAACAGTGGGCGGAGCATGCTCAGCACCATGAGCCCC

CGGCTGTCACTGCTTCTGCTGTGGCTGCTGCTGCTCATCAATGCAGCGCACCCT GTTGGAGCTCTGCCCAGATTGTGTGATGTGCGGCGTGTGCTGCTC

GAGGAACGGGCCGAGTGCCTGCGGGAACTCTCCGAAGAGAAGAAGGCGCTGGGCCCGAAGACAGCATCAG GCTGTGAGAGGTTTTGGGACAACATGAGC

TGCTGGCCCTCCTCGGCACTGGCACAGACAGTGGAAGTGCCATGTCCGAAGTTCCTGAGGATGTTCTCTGGCAGAAATG GGTCTCTGTTCCGGAACTGC

ACAAAGGATGGCTGGTCAGAAACCTTCCCCAGGCCTGACCTGGCCTGTGGGGTCAACATGAATGGCTCCTTTAATGAGAGACGG - UNI36726 - CA

TGCATACCTGCTGAAGCTCAAGGTCATGTACACTGTAGGCTACAGTTCCTCCTTGGCCATGCTCCTGGTCGCCCTCAGCATCCTGTGCTCTTTCCG GAG

GCTGCACTGCACTCGCAACTACATCCACATGCACCTGTTTGTGTCCTTCATCCTTCGCGCCCTGTCCAACTTCATCAAGGACGCCGTACTCTTCCCCGCA

GATGACGTCACCTACTGTGATGCCCACAGG GCAGGCTGCAAGCTGGTCATGATCTTCTTCCAGTACTGCATCATGGCCAACTACGCGTGGCTGCTGGTG

GAGGGCCTCTATCTTCACACGCTCCTGGCCATCTCCTTCTTCTCAGAAAGGAAGTGCCTGCAGGCATTTGTGCTCTTCGGATGGG GTTCTCCAGCCATT

TTTGTTGCTTTGTGGGCTGTCACCAGACACTTTCTGGAGGACTTTGG ATGCTGGGACATCAACTCCAACGCTTCCATCTGGTGGGTCATTCGAGGGCCT

GTGATTCTGTCCATCGTG ATCAATTTCATCTTTTTCATAAACATTCTAAGAATCCTGATGAGAAAACTTAGAACTCAAGAAACAAGAGGAAATGAAACA

CACCATTATAA GCGCCTGGCCAAGTCCACCCTCCTGCTGATCCCTCTCTTTGGCATCCACTACATTGTCTTCGCCTTCTCCCCAGAGGGTGCCATGGAG

GTCCAGCTGTTCTTTGAATTGGCCCTGGGCTCCTTCCAG GGGCTGGTGGTAGCTGTCCTTTACTGCTTCCTCAATGGTGAG CTGGAAGTTCAGAAAAA

ATGGCGCCAGTGGCACCTCCAAGAGTTCCCGCTGCGCCCTGTGGCCCTCAGCAACTCCTTCAGCAACGCCACCAACGGCCCCACCCACAGCACCAAGGCT

GGCACCTCTGAGCAGAGCCGGAGCATCCCCGGGGCCAATGTCATCTGA
Translation
MLSTMSPRLSLLLLWLLLLINAAHP VGALPRLCDVRRVLLEERAECLRELSEEKKALGPKTASG GCERFWDNMSCWPSSALAQTVEVPCPKFLRMFSG

RNG GSLFRNCTKDGWSETFPRPDLACGVNMNGSFNERR - UNI36726 - HAYLLKLKVMYTVGYSSSLAMLLVALSILCSFR RRLHCTRNYIHMH

LFVSFILRALSNFIKDAVLFPADDVTYCDAHR AGCKLVMIFFQYCIMANYAWLLVEGLYLHTLLAISFFSERKCLQAFVLFGWG GSPAIFVALWAVTR

HFLEDFG GCWDINSNASIWWVIRGPVILSIV INFIFFINILRILMRKLRTQETRGNETHHYK KRLAKSTLLLIPLFGIHYIVFAFSPEGAMEVQLFF

ELALGSFQ GLVVAVLYCFLNGE LEVQKKWRQWHLQEFPLRPVALSNSFSNATNGPTHSTKAGTSEQSRSIPGANVI

For any suggestions or comments, please send an email to unitrap@crg.es