Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026393 (Nek7)
Chromosomal location
Chr 1: 140381291 - 140516273 (-)
Description
NIMA (never in mitosis gene a)-related expressed kinase 7 Gene [Source:MGI Symbol;Acc:MGI:1890645]
RefSeq_dna
NM_021605 
RefSeq_peptide
NP_067618.1 
UniGene
Mm.143817 Mm.474125 
MGI
MGI:1890645 
Uniprot/SWISSPROT
Q9ES74 
Uniprot/SPTREMBL
Q3TN15 
Human Ortholog
ENSG00000151414 (NEK7)
Omim not available
UniTrap UNI9910
Vector Insertion
Chr 1: 140458363 - 140516128
Public Clones (sanger) NPX451 (baygenomics) 5SE152C08 (ggtc) E070F03 (ggtc)
3SE152C08 (ggtc) E118G10 (ggtc) E050E06 (ggtc) PST26599-NR (escells)
Private Clones OST450919 (lexicon) OST377479 (lexicon) OST333385 (lexicon) OST296156 (lexicon)
OST166592 (lexicon) OST40937 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1440
Vector Insertion
Chr 1: 140440921 - 140458279
Public Clones CG0643 (sanger) XP0247 (sanger) D083B11 (ggtc)
Private Clones OST117774 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1637
Vector Insertion
Chr 1: 140431004 - 140440779
Public Clones AR1081 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027642
Sequence
GAGGATGGGCCGCCGCTAACCTCGCAGTGGGAAGCGCGGGCCGAGCAGGGTGGGAGCCGGCGCCTGCAGTGGCGCGGGGAGAGGCGATCGGCCCCGGATC

CCGCAGCCCTGCAGCCCGCGTAGACCGAGCTGCCCCGGCGCCCCG - UNI9910 - AATCCTGAAGTCCCAGTTGAGTCAGAATGGATGAACAATCAC

AAGGAATGCAAGGGCCGCCCGTTACTCAGTTCCAGCCACAG - UNI1440 - AAGGCATTACGGCCAGATATGGGCTATAATACTTTAGCCAACTTCC

GAATAGAAAAGAAAATTGGTCGTGGACAATTTAGTGAAGTTTATAGAGCATCCTGTCTCTTGGATGGAGTGCCGGTAGCGTTAAAAAAAGTACAG - UN

I1637 - ATATTTGATTTAATGGATGCCAAAGCACGTGCTGATTGTATCAAAGAAATAGACCTCCTTAAG CAACTCAACCATCCAAATGTAATTAAAT

ACTATGCATCATTCATTGAGGATAATGAGCTGAACATAGTTTTGGAGTTAGCAGATGCTGGTGACCTCTCCAGAATGATAAAG CACTTTAAGAAACAAA

AGAGGCTAATCCCTGAGAGAACCGTTTGGAAATACTTCGTTCAGCTCTGCAGTGCACTGGACCACATGCATTCTCGAAGAGTCATGCACAGAG ATATAA

AACCAGCTAATGTGTTCATTACAGCCACTGGGGTAGTAAAACTCGGAGACCTTGGGCTTGGTCGGTTTTTCAGCTCCAAAACCACAGCTGCACATTCTTT

AG TGGGTACACCTTACTACATGTCTCCAGAGAGAATACATGAAAATGGATACAACTTCAAGTCTGACATCTGGTCTCTTGGCTGTCTGCTATATGAG A

TGGCTGCACTGCAGAGTCCTTTCTACGGCGACAAGATGAACTTGTATTCTCTGTGTAAGAAGATAGAGCAGTGTGACTACCCGCCTCTCCCGTCAGATCA

CTATTCGGAGGAG CTACGACAGCTAGTTAATATATGCATCAACCCAGATCCAGAGAAGCGACCCGACATCGCCTATGTTTATGATGTGGCAAAGAGGAT

GCATGCATGTACCGCAAGCACCTAAACTGTACAAGATCCTGAAGACGGCAACCAAGATAACTTAAAAGTGTTTTTGTGCAGATCATACCTCCCCGCTTAT

GTCTGGGTGTTAAGATTACTGTCTCAGAGCTAATGCGCTTTGAATCCTTAACCAGTTTTCATATGAGCTTCATTTTTCTACCAGGCTCAATCACCTTCCC

AATCCACAACTTTGGGATGCTCAGATGGCACCAAGAATGCAAGCCCAACAAGAGTTTTTCGTTTGAGAATTGTTTCGAGTTTCTGCTGATAGACTGTGTT

TATAGATAGTCAGTGCCCGATGGTGAAGCACACACACATAGGCACATGTCCAGAGCGATGCAGAACCTGAGGAAGGACCTGGGCATTTGACTTGTTTGCT

TTTAAGTCACTTAATGGACGTTGTAGTGGACATGATTGTGAACTTCTGATTTTTTTCTTTTAAGTTTCAAGTACATGTTTTAGTTCTTAGCATTAGAGAT

CTCAAATATAATTCTTATAAGACATGCAGACATAAACTTTTTGAGAAAGATTTAAAATTTTTAGTTTATACATTCAAAATGCAACTATTAAATGTGAAAG

CATAGAGGTCAAAATGTGAGTTGGACACTGAAGTCTATGTTTTAATGCCTTTGAAAGCCTTTTTTTGTGTGTGTTTAAATGGTATAAATGAACCCATTTT

AAAACGTGGTTAAGGACTTGTTTGCCTGGCGTGATAGTCATGTTTAACATGCACAAGGCTTTGTGTTTTTATTGTACATTTGAAGAATATTCTTGGAATA

ATCTTGCAGTAGTTATAGTTCAATTTCTTTACAAATCTAAATACACTTAACTCATAACTATACACTGTAATGCAAGCATATATTGTTATTCATATATTGA

AGTTTTGATCAGTTCCTCTTCAGAATCTTTTTTATCCAAGTTACTTTCTTATTTATATTGTGTGTGCATTTCATCCATTAAATGTTTCAGATTTTCTGAG

AATGAGTTCCCTTTTTAAAATATATTTGGTATGCCAACACTTTTTTAGGATTGAAAAAAAATTTTTTTAAATGTTTGGGTCATTCTAGGTGCATCTGTTT

TCTCTTGTTAGAAAGAAAAGGTGTGTGTTAAAATGTGCCTGTGAATGTCGATATTGTTTGGCAGGGTTATAATTTTAGAGTATGCTCTAGAGTATGTTGA

ACAGCGTGAAGACTGGCCCTTACTGAAGACAGAACTGTTCCAAGAGCAGCATTCCCGTTGAGATGCTTTGGAGTAAAGTACTGTGTATGACGATGACAGA

CATTTTAGTTAAGGGGGTGAAAAAAAAAGGAGGGGTATTTAGGAAACCCTGAGGTGGAATTTTGGTGAATGTCTTCATCTTAATACCAGCCAATTCCTTC

AGAGAATTGTGGAGCCAAAGAACAGAGTAATCGTGGCTGTTGCAGAACACGGTGTGCCATGGTAGAGCATTGGGAAGGCTCATCCTGCCGGTGGGTCGGT

CAGACAGCCCTGTGTTGGGGAGCTTGTACTCTGGCCCACAGAGCTCCTGGGTTGATTTTCTTACAGAGTATTCTTTCTACAGTTATTTTCAAGTAATTGT

AAATTTTCAAAGTAATATCTCATCTTTTAATTCACTATGTATGCTGTCGTAGACAAAGGAAATCTGGGTTTTTTTTTGTTTTTGTTTTTGTTTTTTTTTG

TCTTGAAGGCTGAACTGGGTACATCCCAGATCTTAGTGGCTCATAGGATATACCCAGAGGCATGAAGAAATGGCTTCCGGTGACCATTTGTGTTGTGTTA

TATCCATTGTAATGTCACAGGACTGATTGAGATGAAACATCCCCTTCCTACAAGAGTTGTTTTCTTTCCATATTTAAAAACATGAGGTTCTGCCTGGCAG

TGATGGTACACACCTTTAATCCCAGCACCCGGGAGGCAGAGGCAGGAGGATTTCTGAGTTCGAGGCCAGCCTGGTCTACAAAGTGAGTTCCAGGACAGCC

AGGACTACACAGAGAAATCCTGTCTCAAAAAACCAAAACTAAATGAAAATACAAGGCTTCTCCCCTTGTAGTGACTTTGCTTTATGAATTTGTCTCAAAA

AAAAAAAAAATAGAGCTGGAGGGCTTACTGGTCAGGGATGGTCACTTTAACTTTGTACAAGAAGAAACTTTCTTTCAAATACTTTAAGTCCCTCAGTTCA

TATCCACCCTCCCCCACCAAAATAAAGAATCCATTGTGTAGAAACAAATTCAGTGTGATGTTTGCAAGTGGTTATGGAATTGATTAAAAGTTCTAATCTT

AACAATCACCT
Translation
 - UNI9910 - MDEQSQGMQGPPVTQFQPQ - UNI1440 - KALRPDMGYNTLANFRIEKKIGRGQFSEVYRASCLLDGVPVALKKVQ - UNI16

37 - IFDLMDAKARADCIKEIDLLK QLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIK HFKKQKRLIPERTVWKYFVQLCSALDHMHSRRVMH

RD DIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLV VGTPYYMSPERIHENGYNFKSDIWSLGCLLYE MAALQSPFYGDKMNLYSLCKKIEQCD

YPPLPSDHYSEE LRQLVNICINPDPEKRPDIAYVYDVAKRMHACTAST

For any suggestions or comments, please send an email to unitrap@crg.es