Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026411 (Tmem9)
Chromosomal location
Chr 1: 137914592 - 137931603 (+)
Description
transmembrane protein 9 Gene [Source:MGI (curated);Acc:Tmem9-002]
RefSeq_dna
NM_025439 
RefSeq_peptide
NP_079715.1 
UniGene
Mm.41773 
MGI
MGI:1913491 
Uniprot/SWISSPROT
Q9CR23 
Human Ortholog
ENSG00000116857 (TMEM9)
Omim not available
UniTrap UNI34566
Vector Insertion
Chr 1: 137914826 - 137915082
Public Clones IST13568C12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11194
Vector Insertion
Chr 1: 137916327 - 137921194
Public Clones G086H11 (ggtc) G076E07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000117950
Sequence
GGTTGGTAGACTCGGCATTGGGGGAGGGGTACGGGGGTCGCAGGGACACTGGGGGTTCACAGCCACCCCAAATCCTTAGGCAGGGTGTGCAGTACTCTTG

GCGGTCGGAATCGGGGCTTCTGGTTGGGCCTGAGCGGCGCCACCAGGGCGGTGGAGGCAGAGATGGCGGAGGGCGGTGGGAGGAGAG - UNI34566 -

 GCATCTAGTCTTGCTGGCTCAGCAAGCCCGATAAGCATGAAGCTGCTGTGTTTGGTGGCTGTGGTGGGGTGCTTGCTGGTGCCCCCAGCTCAAGCCAAC

AAG AGCTCTGAAGATATCCGGTGCAAATGCATCTGTCCGCCTTACAGAAACATCAGCGGGCACATTTACAACCAGAATGTGTCTCAGAAGGACTG - U

NI11194 - CAACTGCCTGCATGTGGTGGAGCCCATGCCAGTGCCTGGCCACGATGTGGAAGCCTACTGCCTGCTCTGCGAGTGTAGGTACGAGGAGCG

TAGCACCACAACCATCAAG GTCATTATTGTCATCTACCTGTCTGTGGTGGGGGCCCTCTTACTCTACATGGCCTTCCTGATGCTGGTGGACCCGCTCAT

CCGGAAGCCAGATGCCTATACTGAGCAGCTGCACAATGAAGAGGAGAATGAG GATGCTCGCACCATGGCAACAGCCGCTGCGTCCATTGGAGGACCCCG

GGCAAACACTGTCCTGGAGCGGGTGGAAGGCGCTCAGCAGCGGTGGAAGCTGCAGGTGCAGGAGCAGCGGAAGACGGTCTTCGACCGACACAAGATGCTC

AGTTAGATGGTTGCCATGATTGCATCAGAGACCTGGGCCATGGCTACCAGCTTCTGGGGCTCACTGCAGTCTTCCCTG
Translation
 - UNI34566 - MKLLCLVAVVGCLLVPPAQANK SSEDIRCKCICPPYRNISGHIYNQNVSQKDC - UNI11194 - CNCLHVVEPMPVPGHDVE

AYCLLCECRYEERSTTTIK VIIVIYLSVVGALLLYMAFLMLVDPLIRKPDAYTEQLHNEEENE DARTMATAAASIGGPRANTVLERVEGAQQRWKLQV

QEQRKTVFDRHKMLS
Transcript ENSMUST00000118832
Sequence
GAAGGGGTGGAGCCTGCTGATCAGTGGCGGCTGCGGCTGAGCTTGCAG - UNI34566 - GCATCTAGTCTTGCTGGCTCAGCAAGCCCGATAAGCAT

GAAGCTGCTGTGTTTGGTGGCTGTGGTGGGGTGCTTGCTGGTGCCCCCAGCTCAAGCCAACAAG AGCTCTGAAGATATCCGGTGCAAATGCATCTGTCC

GCCTTACAGAAACATCAGCGGGCACATTTACAACCAGAATGTGTCTCAGAAGGACTG - UNI11194 - CAACTGCCTGCATGTGGTGGAGCCCATGC

CAGTGCCTGGCCACGATGTGGAAGCCTACTGCCTGCTCTGCGAGTGTAGGTACGAGGAGCGTAGCACCACAACCATCAAG GTCATTATTGTCATCTACC

TGTCTGTGGTGGGGGCCCTCTTACTCTACATGGCCTTCCTGATGCTGGTGGACCCGCTCATCCGGAAGCCAGATGCCTATACTGAGCAGCTGCACAATGA

AGAGGAGAATGAG GATGCTCGCACCATGGCAACAGCCGCTGCGTCCATTGGAGGACCCCGGGCAAACACTGTCCTGGAGCGGGTGGAAGGCGCTCAGCA

GCGGTGGAAGCTGCAGGTGCAGGAGCAGCGGAAGACGGTCTTCGACCGACACAAGATGCTCAGTTAGATGGTTGCCATGATTGCATCAGAGACCTGGGCC

ATGGCTACCAGCTTCTGGGGCTCACTGCAGTCTTCCCTGGGTCTTCCCTTCAAATGCCCATGGCGTTTATCCTTCTCCCTCTCTAGAAATGTACTCGACT

GTTATAACGAGGGAGTGTGATTGGGTCTCTGTAG CTCTCCTCGGCTCCTGGTCCACCAGTGCATGGCAGTGCCCATGCATGCCGGCATATTCAGCAGCT

GTCACCTTACTCCCATCCCAGGAGGCCGTAAGGCCTCCCACCTCTCCCCTGTGACTGCAGCTGCTGAGCCATAAAGTTGGACCATATGACACAAGGCCAA

TGGGGACCGGAGTACCATGGCTCCTGTCCTTGGATGGTCTCTTGTCCCTGAATTTCATTGTATCATGCATGGAGAGAAATGTTTGTCTTTCTGTTGTCTA

TACATCAAAGAAGCCATTAAATTGTTTTATTTC
Translation
 - UNI34566 - MKLLCLVAVVGCLLVPPAQANK SSEDIRCKCICPPYRNISGHIYNQNVSQKDC - UNI11194 - CNCLHVVEPMPVPGHDVE

AYCLLCECRYEERSTTTIK VIIVIYLSVVGALLLYMAFLMLVDPLIRKPDAYTEQLHNEEENE DARTMATAAASIGGPRANTVLERVEGAQQRWKLQV

QEQRKTVFDRHKMLS 
Transcript ENSMUST00000063719
Sequence
GCGGCTGAGCTTGCAG - UNI34566 - GCATCTAGTCTTGCTGGCTCAGCAAGCCCGATAAGCATGAAGCTGCTGTGTTTGGTGGCTGTGGTGGGGT

GCTTGCTGGTGCCCCCAGCTCAAGCCAACAAG AGCTCTGAAGATATCCGGTGCAAATGCATCTGTCCGCCTTACAGAAACATCAGCGGGCACATTTACA

ACCAGAATGTGTCTCAGAAGGACTG - UNI11194 - CAACTGCCTGCATGTGGTGGAGCCCATGCCAGTGCCTGGCCACGATGTGGAAGCCTACTGC

CTGCTCTGCGAGTGTAGGTACGAGGAGCGTAGCACCACAACCATCAAG GTCATTATTGTCATCTACCTGTCTGTGGTGGGGGCCCTCTTACTCTACATG

GCCTTCCTGATGCTGGTGGACCCGCTCATCCGGAAGCCAGATGCCTATACTGAGCAGCTGCACAATGAAGAGGAGAATGAG GATGCTCGCACCATGGCA

ACAGCCGCTGCGTCCATTGGAGGACCCCGGGCAAACACTGTCCTGGAGCGGGTGGAAGGCGCTCAGCAGCGGTGGAAGCTGCAGGTGCAGGAGCAGCGGA

AGACGGTCTTCGACCGACACAAGATGCTCAGTTAGATGGTTGCCATGATTGCATCAGAGACCTGGGCCATGGCTACCAGCTTCTGGGGCTCACTGCAGTC

TTCCCTGGGTCTTCCCTTCAAATGCCCATGGCGTTTATCCTTCTCCCTCTCTAGAAATGTACTCGACTGTTATAACGAGGGAGTGTGATTGGGTCTCTGT

AGGTCTCTGGGGGGTAGAGGGGAGGGGAGGGAAGGCAGAAGGGAACAGAGACATTTGAGGTGGCCACATGATTGGGTGGAATTCATCCCTCCTGTCTTCA

CCATTCCTCCCAGCTCCACATCTTAAGGATGCTTACGGGAGACGAAGCTGTGTCATCAAGAGCTCAGTGGGTGCGAGGAAAGTATGATCCAGCGCTCAGC

CTTCGCTCTAGGATGCTGTGGTCCCCATTCCCAGTTCCTCCAGTGCCAGTACTTTAGCTTGGCCTAGCCCCAGTCTCAGGAACTGTTGTGGTGCCCCTGA

GCCCACAGTCATCTCCAGAGTCCACCTGGAAGCCTGTTCCCCTCTCCTCGGCTCCTGGTCCACCAGTGCATGGCAGTGCCCATGCATGCCGGCATATTCA

GCAGCTGTCACCTTACTCCCATCCCAGGAGGCCGTAAGGCCTCCCACCTCTCCCCTGTGACTGCAGCTGCTGAGCCATAAAGTTGGACCATATGACACAA

GGCCAATGGGGACCGGAGTACCATGGCTCCTGTCCTTGGATGGTCTCTTGTCCCTGAATTTCATTGTATCATGCATGGAGAGAAATGTTTGTCTTTCTGT

TGTCTATACATCAAAGAAGCCATTAAATTGTTTTATTTCTC
Translation
 - UNI34566 - MKLLCLVAVVGCLLVPPAQANK SSEDIRCKCICPPYRNISGHIYNQNVSQKDC - UNI11194 - CNCLHVVEPMPVPGHDVE

AYCLLCECRYEERSTTTIK VIIVIYLSVVGALLLYMAFLMLVDPLIRKPDAYTEQLHNEEENE DARTMATAAASIGGPRANTVLERVEGAQQRWKLQV

QEQRKTVFDRHKMLS

For any suggestions or comments, please send an email to unitrap@crg.es