Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026418 (Tnni1)
Chromosomal location
Chr 1: 137701424 - 137707564 (+)
Description
troponin I, skeletal, slow 1 Gene [Source:MGI Symbol;Acc:MGI:105073]
RefSeq_peptide
NP_067442.1 NP_001106173.1 
MGI
MGI:105073 
Uniprot/SWISSPROT
Q9WUZ5 
Human Ortholog
ENSG00000159173 (TNNI1)
Omim not available
UniTrap UNI26714
Vector Insertion
Chr 1: 137701439 - 137701629
Public Clones CMHD-GT_487E1-3 (cmhd)
Private Clones OST101840 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28426
Vector Insertion
Chr 1: 137704188 - 137705209
Public Clones not available
Private Clones OST31306 (lexicon) OST31272 (lexicon)
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027674
Sequence
CTACCAGCAGTAGAG - UNI26714 - AGGAAATCCAAGATCACTGCCTCCCGTAAACTCATGCTGAAG AGCCTGATGCTAGCCAAGGCCAAGGAGT

GTTGGGAGCAGGAACACGAGGAGCGAGAGGCTGAGAAGGTGCGTTACCTCTCGGAGCGCATTCCCACACTGCAGACCCGCGGTCTGTCTCTCAGTGCCCT

TCAG GACTTGTGCCGAGAGCTCCATGCCAAGGTAGAGGTGGTGGATGAGGAGCGCTATGATATTGAAGCCAAATGCCTCCACAACACCAGAGAG - UN

I28426 - ATCAAGGACCTGAAGCTGAAGGTGCTGGACCTCCGTGGGAAGTTCAAGCGTCCTCCCCTGCGCCGGGTCCGTGTCTCAGCCGATGCCATGC

TCCGAGCCCTACTGGGCTCTAAGCACAAGGTGTCCATGGATCTGCGGGCCAACCTCAAGTCTGTGAAGAAAGAAGACACAGAAAAG GAGCGGCCAGTCG

AGGTAGGAGACTGGAGGAAGAATGTGGAGGCTATGTCTGGCATGGAAGGCCGCAAGAAGATGTTCGACGCTGCTAAGTCCCCGACCTCCCAGTAGAG GT

TGGCTTGCTGTATGACACTCTGTGTCATGCTTTGGTCCCTTTCCAGCCCCACTCACCTATCTTTCTGCTCGTGCCTGGAACATCCCTAATATGCGCTCCC

TCCCTCCAGCCTATGCACACACCTTTGGAGCCAGGATGAAATGGCGCACAAAGGGGAAGAGAGATGCCAGTGCCTGGGACCTCATCCCAGCAGTGTGGGC

TTATGGTACCCGCTGGGCATGCTGGGGTTATCCAGTCACCCCAAGGGGCCCTAGGCTGAGGAGGGAGGCAGAGAGAACTGCCTCTCAGCAGCCCCGTGTT

GCTTCCCTCCATCTCTGTTGCTACCTGCAGTATTCACAAGTTCTCCATTAAAAAAAAAAAAAGATCCAGGTTT
Translation
LPAVE - UNI26714 - RKSKITASRKLMLK SLMLAKAKECWEQEHEEREAEKVRYLSERIPTLQTRGLSLSALQ DLCRELHAKVEVVDEERYDIE

AKCLHNTRE - UNI28426 - IKDLKLKVLDLRGKFKRPPLRRVRVSADAMLRALLGSKHKVSMDLRANLKSVKKEDTEK ERPVEVGDWRKNVEAMS

GMEGRKKMFDAAKSPTSQ 

For any suggestions or comments, please send an email to unitrap@crg.es