Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026426 (Arl8a)
Chromosomal location
Chr 1: 137043411 - 137052845 (+)
Description
ADP-ribosylation factor-like 8A Gene [Source:MGI Symbol;Acc:MGI:1915974]
RefSeq_dna
NM_026823 
RefSeq_peptide
NP_081099.1 
UniGene
Mm.391898 
MGI
MGI:1915974 
Uniprot/SWISSPROT
Q8VEH3 
Human Ortholog
ENSG00000143862 (ARL8A)
Omim not available
UniTrap UNI26877
Vector Insertion
Chr 1: 137043678 - 137049047
Public Clones not available
Private Clones OST88770 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17873
Vector Insertion
Chr 1: 137049129 - 137049369
Public Clones not available
Private Clones OST434546 (lexicon)
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027684
Sequence
GCGTCGTCGGCCGCCGCGCTCCAGCCTCCGCCCGCACCGAGCCGCGGGACCCGGCCGCACCGGGGAGGGGCCGCTCCGGGCCGCAGCGCGAGGGCACCGA

AGGCGGCGGGGACCCGGCACCGGGCGCGGCCGGTGGCAGCGACCATGATCGCTTTGTTCAACAAGCTGCTGGACTGGTTCAAGGCCCTGTTCTGGAAGGA

GGAAATGGAGCTCACGCTGGTGGGGCTGCAGTACTCGGGCAAGACCACCTTCGTCAACGTGATCGCG - UNI26877 - TCAGGACAGTTCAATGAGG

ACATGATCCCCACTGTGGGTTTCAACATGCGAAAAATCACCAAAGGGAATGTGACCATCAAG - UNI17873 - CTCTGGGACATTGGGGGGCAGCCC

CGTTTCCGAAGCATGTGGGAACGCTACTGCAGAGGAGTGAGCGCCATTGT GTATATGGTGGATGCTGCGGATCAGGAGAAGATCGAGGCCTCCAAGAAT

GAGCTCCACAACCTGCTAGACAAGCCACAGCTACAAGGCATCCCG GTCTTAGTCCTTGGTAACAAGCGAGACCTCGCCGGAGCGCTAGATGAGAAGGAG

CTAATCGAGAAAAT GAACCTGTCTGCTATCCAGGACCGAGAGATCTGCTGCTACTCCATATCCTGCAAAGAGAAGGACAACATAG ACATCACCCTACA

GTGGCTTATTCAACACTCAAAGTCACGGAGAAGCTGAGACTGTGGCTCTTCTTCTGACTAGGGACCACAGTCACCTAACCTGAAGCCGAGCTCCCCGCCC

ACCCTGTTGTCTCTCCCTAAGCCCACTCCTCCTCACCCAGTGTGGGGAGGGCCCTCTGGGGCTCCTAGAGCCCTATTCTGCTGAGGTTTCAACTCCTGTT

TTTATTGTAAAATAATTGCCCTCTCCCCAAGTCTGGTCCCCTAACCTCTCTCCCTTGCTCTCTTTTTCCCTTCAGCTACCCCACTCCCCTCCCTGTCAAC

AGCCCTGGCCCCGCAAGCCCTCTCCTCACTCTCTGCCCCACCCTCCTCTTCCCCTTTCAACACTCTGTTATTGTCCTGTGTGTACAGTATATATATGTAT

ATATATTTTAATTTTTTAATTTAAGCAAAGACTAAGATCAACCATTTGATGCTGCAGGGGCCAATCGGGACCTGGGAGGGGCAAACTGGAAAGGCAGAGA

GAGATGCAGGGTCGATGTGGGGCAAGTTCATATGCAGAAGAGGGGAGACTGCCACATAGGGCAGTGGTTGTCCCCATGTCCTGTAAAGTATCTCTGTCTC

CCAGTGGAGGACCTGAATTTGAAGGCCAGCAGGAGCCTCCTTTTCTGTCCCCAGCCTTGATAGGGCCACCAGGTACAACCAGGTCTAAGAGGGAGGACCA

GGGTCCATGTCGTCCCAGCAACCCCCACTGTCACTGTTCCTGGCCCCAGGTCCTGCCCCTACCCAGGGTCCCCACCTCCACGGCCCATCTCATTTTCTGT

TCTCATTTCACAGAGTTGTACAAGGAGAGAACTCAGCATGGGAGGGTTGGTTCTTTGGTTTTGTTTGTTTGTTTGTTTGTTTGTTTAATTTAATAATTTG

TAAAGTGATGTTCCTCTTCCTTTTTACAGTTTTCAGCTCATATTTAACCTCTGTTTGGAAAACGATCCTTGTAACTGTACATTTTTTTTTTTGCCTCCTA

ATAATGACAACAATAAATTACCAATTTTGTGTTG
Translation
MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIA - UNI26877 - SGQFNEDMIPTVGFNMRKITKGNVTIK - UNI17873 - LWDI

GGQPRFRSMWERYCRGVSAIV VYMVDAADQEKIEASKNELHNLLDKPQLQGIP VLVLGNKRDLAGALDEKELIEKM MNLSAIQDREICCYSISCKEK

DNID DITLQWLIQHSKSRRS

For any suggestions or comments, please send an email to unitrap@crg.es