Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026427 (Lgtn)
Chromosomal location
Chr 1: 133049773 - 133079463 (+)
Description
ligatin Gene [Source:MGI (curated);Acc:Lgtn-005]
RefSeq_dna
NM_010709 
RefSeq_peptide
NP_034839.1 NP_001129542.1 
UniGene
Mm.400238 
MGI
MGI:109342 
Uniprot/SWISSPROT
Q61211 
Uniprot/SPTREMBL
Q8C8I3 
Human Ortholog
ENSG00000143486 (LGTN)
Omim not available
UniTrap UNI18985
Vector Insertion
Chr 1: 133050003 - 133050805
Public Clones (sanger)
Private Clones OST407711 (lexicon) OST389811 (lexicon) OST371809 (lexicon) OST354101 (lexicon)
OST280308 (lexicon) OST172600 (lexicon) OST103941 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16423
Vector Insertion
Chr 1: 133051829 - 133052209
Public Clones not available
Private Clones OST461521 (lexicon) OST251070 (lexicon)
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3977
Vector Insertion
Chr 1: 133052301 - 133054768
Public Clones AR1138 (sanger)
Private Clones OST235488 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27865
Vector Insertion
Chr 1: 133054877 - 133056986
Public Clones not available
Private Clones OST45505 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38680
Vector Insertion
Chr 1: 133057202 - 133057861
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29750
Vector Insertion
Chr 1: 133057980 - 133060096
Public Clones E084D10 (ggtc) E084H12 (ggtc) E084C09 (ggtc) E084E09 (ggtc) E084D09 (ggtc)
E084G10 (ggtc) E084B10 (ggtc) E084E07 (ggtc) E084C10 (ggtc) E084G09 (ggtc)
E084A07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27957
Vector Insertion
Chr 1: 133061787 - 133062903
Public Clones not available
Private Clones OST43362 (lexicon)
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19750
Vector Insertion
Chr 1: 133063000 - 133064696
Public Clones not available
Private Clones OST381941 (lexicon)
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15198
Vector Insertion
Chr 1: 133067689 - 133068497
Public Clones PST9972-NR (escells) PST11278-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112446
Sequence
GGCGCCGAGTCTCAGCATGGCTGCCTCCAGGGTTGAGGGTCCGGGAGCCGCCACTCCTTCGTTTTGTTGACCGCCCCTGGCGTCTGTGCTCTTCTTGTCT

TTCCTGAGCTACTCCAGCAGACATGTTCGCTAAGGCCTTTCGGGTCAAGTCCAACACAGCCATCAAGGGCTCGGACAG - UNI18985 - GAGAAAGC

TCCGGGCCGATGTGACAGCTGCTTTCCCTGCCCTGGGAACAGATCAGATCTCTGAATTGATACCTGGAAAGGAAGAGCTAAATGTTGTGAAGTTGTATGT

TCACAAAGGGGATTCGGTGACTGTGTACACGAGTGGTGGTAACCCCATCCTATTTGAACTGGAGAAAAATTTGTATCCAACAG TGTACACACTGTGGGC

CTATCCGGATATTCTACCAACTTTTATAACATGGCCTCTGGTATTGGAAAAACTGGTCGGGGGAGCAG - UNI16423 - ATTTGATGCTGCCAGGGG

TAGTGGTGCCCCCTACTGGTCTTCCTCAAGTACAGCAAGGCGACCTCTGTGCCATTGCCTTGGTGGGGAACAG - UNI3977 - AGCGCCCGTTGCAA

TTGGAGTGGCCGCCATGTCCACAGCTCAGATGCTGGCTTCAGGCCTGAAGGGAAAAGGTGTCTCTGTGCTCCACACTTATCAGGACCACTTGTG - UNI

27865 - GAGATCTGGAGACAAGTCCTCTCCACCTGCCATTGCCCCACTGGACCCCACAGATAGCTGCGAAGAGAAGGTGCACCTTGGTCTGCAGGGAA

ACCTGAAGAGCCTGACCCTGGACGGAGAGGAGGAGAACGGGCAGGTTCCTCTCCGAGAAGCCTCTGAGGACACCAGCTCCAGGGCCCCGAGCCAGGATTC

CTTGGACGGCAAGCCCCTTCAGG AACAAATGGACGATCTGTTACTGCGGTGCTTCCTTCATGCCCTGAAGAGTCGAGTCAAGAAAGCTGACCTCCCGTT

GCTCACCAGCACTCTCCTTGGCAGTCACATGTTCTCCTGCTG - UNI29750 - TCCTGAAGGACAGCAACTGGATATAAAGAAGTCAAGCTATAAAA

AG CTCTCTAAGTTCCTGCAGCACATGCAGCAGGAGCAGATTGTCCAGGTCAAGGAGCTGAGCAAAGGGGTGGAGAGCATTGTGGCTGTGGACTGGAGGC

ACCCGAG GATCACGTCTTTCGTCATCCCCGAGCCTTCCCTGACTTCCCAGACTGTCCAGGAAGTTAGCAGGGAACAGCCCTATCTCCCTCCAGATATAA

AATCCCTCTACTGTGTCCCAGCCAACATGACCCAGCTCTTCCTGGAGTCTGGCCACAA GAAGGGGAGCACCCTTGAGGGCAGTGAGGTCCGAAAGATCA

TCACGGACTATGCCAAGAGAAACAGACTGGTGGATGCAGACAACAGAAA - UNI27957 - TCTGGTGAAGTTGGATCCTATCTTATGTGACTGCATC

TTAGAGAAAAATGAGCAGCACTTGGTCACGAAGCTCCCATGGGACTGTCTCCTGACCAG - UNI19750 - GTGTTTGAAAAATATGCAGCCTGCCTA

CCAAGTAACATTTCCTGGCCAGGAACCCATTCTAAAGAAAGGGAAACTCTGTCCAATTGATATCACCCTTGCACTGAAGACCTATAATAAAAAG GTGAC

TGTGGTCCGGAACTTGGAGACCTATGGTCTAGATCCGTGCTCAGTGGCCGCCATTCTCCAGCAGCGATGTCAGGCAAGCACCATCGTCTCTCCTGCCCCT

GGGGCCAAAGACAGTCTGCAGGTGCAGGTCCAGGGAAACCAGATCCACCACCTTGGCCAGCTACTGCTTG - UNI15198 - AAATCATGTGGTGAGC

CCCGGCAGTGCCTGGAGCTCAGCGGTGCTGTGACAGGGATCCCCTTGCTTATAACTGTGCTGCAGGACTGTTGCCTGTATTGCAGATGGGAAAACTGAGG

TCCAGCGAAACTCAGTACCTTGCCTGGAACTCACCTAACTCTTGAGTACTGTAGCCAGGCTCTGAATCTTTTTATTCTTTAGAGCCAAAATTCTTTAGAT

TCCCTCTGGGTCTTTAGCCTCTTCTTTGTCCTTCATTTAAGTCCTCCAAAGTTCTGCCTCAGTCAGCTTTCTAAAGTAAATATAATCTTGTCACTCTC
Translation
MFAKAFRVKSNTAIKGSDR - UNI18985 - RRKLRADVTAAFPALGTDQISELIPGKEELNVVKLYVHKGDSVTVYTSGGNPILFELEKNLYPTV V

YTLWAYPDILPTFITWPLVLEKLVGGAD - UNI16423 - DLMLPGVVVPPTGLPQVQQGDLCAIALVGNR - UNI3977 - RAPVAIGVAAMSTA

QMLASGLKGKGVSVLHTYQDHLW - UNI27865 - WRSGDKSSPPAIAPLDPTDSCEEKVHLGLQGNLKSLTLDGEEENGQVPLREASEDTSSRAPSQ

DSLDGKPLQE EQMDDLLLRCFLHALKSRVKKADLPLLTSTLLGSHMFSCC - UNI29750 - CPEGQQLDIKKSSYKK LSKFLQHMQQEQIVQVKE

LSKGVESIVAVDWRHPR RITSFVIPEPSLTSQTVQEVSREQPYLPPDIKSLYCVPANMTQLFLESGHK KKGSTLEGSEVRKIITDYAKRNRLVDADNR

N - UNI27957 - NLVKLDPILCDCILEKNEQHLVTKLPWDCLLTR - UNI19750 - RCLKNMQPAYQVTFPGQEPILKKGKLCPIDITLALKTY

NKK VTVVRNLETYGLDPCSVAAILQQRCQASTIVSPAPGAKDSLQVQVQGNQIHHLGQLLLE - UNI15198 - EIMW
Transcript ENSMUST00000068805
Sequence
AGTTCCGGGCCAGCATCAGGGCTAGGGCCGGGTTCCTAGCAGGCTGTTTTTTGGCGCCGAGTCTCAGCATGGCTGCCTCCAGGGTTGAGGGTCCGGGAGC

CGCCACTCCTTCGTTTTGTTGACCGCCCCTGGCGTCTGTGCTCTTCTTGTCTTTCCTGAGCTACTCCAGCAGACATGTTCGCTAAGGCCTTTCGGGTCAA

GTCCAACACAGCCATCAAGGGCTCGGACAG - UNI18985 - GAGAAAGCTCCGGGCCGATGTGACAGCTGCTTTCCCTGCCCTGGGAACAGATCAGA

TCTCTGAATTGATACCTGGAAAGGAAGAGCTAAATGTTGTGAAGTTGTATGTTCACAAAGGGGATTCGGTGACTGTGTACACGAGTGGTGGTAACCCCAT

CCTATTTGAACTGGAGAAAAATTTGTATCCAACAG TGTACACACTGTGGGCCTATCCGGATATTCTACCAACTTTTATAACATGGCCTCTGGTATTGGA

AAAACTGGTCGGGGGAGCAG - UNI16423 - ATTTGATGCTGCCAGGGGTAGTGGTGCCCCCTACTGGTCTTCCTCAAGTACAGCAAGGCGACCTCT

GTGCCATTGCCTTGGTGGGGAACAG - UNI3977 - AGCGCCCGTTGCAATTGGAGTGGCCGCCATGTCCACAGCTCAGATGCTGGCTTCAGGCCTGA

AGGGAAAAGGTGTCTCTGTGCTCCACACTTATCAGGACCACTTGTG - UNI27865 - GAGATCTGGAGACAAGTCCTCTCCACCTGCCATTGCCCCA

CTGGACCCCACAGATAGCTGCGAAGAGAAGGTGCACCTTGGTCTGCAGGGAAACCTGAAGAGCCTGACCCTGGACGGAGAGGAGGAGAACGGGCAGGTTC

CTCTCCGAGAAGCCTCTGAGGACACCAGCTCCAGGGCCCCGAGCCAGGATTCCTTGGACGGCAAGCCCCTTCAGG AACAAATGGACGATCTGTTACTGC

GGTGCTTCCTTCATGCCCTGAAGAGTCGAGTCAAGAAAGCTGACCTCCCGTTGCTCACCAGCACTCTCCTTGGCAGTCACATGTTCTCCTGCTG - UNI

29750 - TCCTGAAGGACAGCAACTGGATATAAAGAAGTCAAGCTATAAAAAG CTCTCTAAGTTCCTGCAGCACATGCAGCAGGAGCAGATTGTCCAG

GTCAAGGAGCTGAGCAAAGGGGTGGAGAGCATTGTGGCTGTGGACTGGAGGCACCCGAG GATCACGTCTTTCGTCATCCCCGAGCCTTCCCTGACTTCC

CAGACTGTCCAGGAAGTTAGCAGGGAACAGCCCTATCTCCCTCCAGATATAAAATCCCTCTACTGTGTCCCAGCCAACATGACCCAGCTCTTCCTGGAGT

CTGGCCACAA GAAGGGGAGCACCCTTGAGGGCAGTGAGGTCCGAAAGATCATCACGGACTATGCCAAGAGAAACAGACTGGTGGATGCAGACAACAGAA

A - UNI27957 - TCTGGTGAAGTTGGATCCTATCTTATGTGACTGCATCTTAGAGAAAAATGAGCAGCACTTGGTCACGAAGCTCCCATGGGACTGT

CTCCTGACCAG - UNI19750 - GTGTTTGAAAAATATGCAGCCTGCCTACCAAGTAACATTTCCTGGCCAGGAACCCATTCTAAAGAAAGGGAAACT

CTGTCCAATTGATATCACCCTTGCACTGAAGACCTATAATAAAAAG GTGACTGTGGTCCGGAACTTGGAGACCTATGGTCTAGATCCGTGCTCAGTGGC

CGCCATTCTCCAGCAGCGATGTCAGGCAAGCACCATCGTCTCTCCTGCCCCTGGGGCCAAAGACAGTCTGCAGGTGCAGGTCCAGGGAAACCAGATCCAC

CACCTTGGCCAGCTACTGCTTG - UNI15198 - AAGAGTATCGGCTCCCTGGAAAATACATCCAAGGCCTAGAAAAGGCCCCCAAACCTGGCAAGAA

GTGACAGACTCATTTTATGCAGTGGACCCCATGGGAACCCAGGTTCTGAGCTGGTAACTGATACGAGCAGTTTTGGCTTTTGCAAATAAAAACTGTAATT

CTTT
Translation
MFAKAFRVKSNTAIKGSDR - UNI18985 - RRKLRADVTAAFPALGTDQISELIPGKEELNVVKLYVHKGDSVTVYTSGGNPILFELEKNLYPTV V

YTLWAYPDILPTFITWPLVLEKLVGGAD - UNI16423 - DLMLPGVVVPPTGLPQVQQGDLCAIALVGNR - UNI3977 - RAPVAIGVAAMSTA

QMLASGLKGKGVSVLHTYQDHLW - UNI27865 - WRSGDKSSPPAIAPLDPTDSCEEKVHLGLQGNLKSLTLDGEEENGQVPLREASEDTSSRAPSQ

DSLDGKPLQE EQMDDLLLRCFLHALKSRVKKADLPLLTSTLLGSHMFSCC - UNI29750 - CPEGQQLDIKKSSYKK LSKFLQHMQQEQIVQVKE

LSKGVESIVAVDWRHPR RITSFVIPEPSLTSQTVQEVSREQPYLPPDIKSLYCVPANMTQLFLESGHK KKGSTLEGSEVRKIITDYAKRNRLVDADNR

N - UNI27957 - NLVKLDPILCDCILEKNEQHLVTKLPWDCLLTR - UNI19750 - RCLKNMQPAYQVTFPGQEPILKKGKLCPIDITLALKTY

NKK VTVVRNLETYGLDPCSVAAILQQRCQASTIVSPAPGAKDSLQVQVQGNQIHHLGQLLLE - UNI15198 - EEYRLPGKYIQGLEKAPKPGKK
Transcript ENSMUST00000068791
Sequence
AGTTCCGGGCCAGCATCAGGGCTAGGGCCGGGTTCCTAGCAGGCTGTTTTTTGGCGCCGAGTCTCAGCATGGCTGCCTCCAGGGTTGAGGGTCCGGGAGC

CGCCACTCCTTCGTTTTGTTGACCGCCCCTGGCGTCTGTGCTCTTCTTGTCTTTCCTGAGCTACTCCAGCAGACATGTTCGCTAAGGCCTTTCGGGTCAA

GTCCAACACAGCCATCAAGGGCTCGGACAG - UNI18985 - GAGAAAGCTCCGGGCCGATGTGACAGCTGCTTTCCCTGCCCTGGGAACAGATCAGA

TCTCTGAATTGATACCTGGAAAGGAAGAGCTAAATGTTGTGAAGTTGTATGTTCACAAAGGGGATTCGGTGACTGTGTACACGAGTGGTGGTAACCCCAT

CCTATTTGAACTGGAGAAAAATTTGTATCCAACAG TGTACACACTGTGGGCCTATCCGGATATTCTACCAACTTTTATAACATGGCCTCTGGTATTGGA

AAAACTGGTCGGGGGAGCAG - UNI16423 - ATTTGATGCTGCCAGGGGTAGTGGTGCCCCCTACTGGTCTTCCTCAAGTACAGCAAGGCGACCTCT

GTGCCATTGCCTTGGTGGGGAACAG - UNI3977 - AGCGCCCGTTGCAATTGGAGTGGCCGCCATGTCCACAGCTCAGATGCTGGCTTCAGGCCTGA

AGGGAAAAGGTGTCTCTGTGCTCCACACTTATCAGGACCACTTGTG - UNI27865 - GAGATCTGGAGACAAGTCCTCTCCACCTGCCATTGCCCCA

CTGGACCCCACAGATAGCTGCGAAGAGAAGGTGCACCTTGGTCTGCAGGGAAACCTGAAGAGCCTGACCCTGGACGGAGAGGAGGAGAACGGGCAGGTTC

CTCTCCGAGAAGCCTCTGAGGACACCAGCTCCAGGGCCCCGAGCCAGGATTCCTTGGACGGCAAGCCCCTTCAGG AACAAATGGACGATCTGTTACTGC

GGTGCTTCCTTCATGCCCTGAAGAGTCGAGTCAAGAAAGCTGACCTCCCGTTGCTCACCAGCACTCTCCTTGGCAGTCACATGTTCTCCTGCTG - UNI

29750 - TCCTGAAGGACAGCAACTGGATATAAAGAAGTCAAGCTATAAAAAG CTCTCTAAGTTCCTGCAGCACATGCAGCAGGAGCAGATTGTCCAG

GTCAAGGAGCTGAGCAAAGGGGTGGAGAGCATTGTGGCTGTGGACTGGAGGCACCCGAG GAAGGGGAGCACCCTTGAGGGCAGTGAGGTCCGAAAGATC

ATCACGGACTATGCCAAGAGAAACAGACTGGTGGATGCAGACAACAGAAA - UNI27957 - TCTGGTGAAGTTGGATCCTATCTTATGTGACTGCAT

CTTAGAGAAAAATGAGCAGCACTTGGTCACGAAGCTCCCATGGGACTGTCTCCTGACCAG - UNI19750 - GTGTTTGAAAAATATGCAGCCTGCCT

ACCAAGTAACATTTCCTGGCCAGGAACCCATTCTAAAGAAAGGGAAACTCTGTCCAATTGATATCACCCTTGCACTGAAGACCTATAATAAAAAG - UN

I15198 - TTGATGGATCTTGTCCTGCTCCTCTTTTTCCAGGATAGTTAA
Translation
MFAKAFRVKSNTAIKGSDR - UNI18985 - RRKLRADVTAAFPALGTDQISELIPGKEELNVVKLYVHKGDSVTVYTSGGNPILFELEKNLYPTV V

YTLWAYPDILPTFITWPLVLEKLVGGAD - UNI16423 - DLMLPGVVVPPTGLPQVQQGDLCAIALVGNR - UNI3977 - RAPVAIGVAAMSTA

QMLASGLKGKGVSVLHTYQDHLW - UNI27865 - WRSGDKSSPPAIAPLDPTDSCEEKVHLGLQGNLKSLTLDGEEENGQVPLREASEDTSSRAPSQ

DSLDGKPLQE EQMDDLLLRCFLHALKSRVKKADLPLLTSTLLGSHMFSCC - UNI29750 - CPEGQQLDIKKSSYKK LSKFLQHMQQEQIVQVKE

LSKGVESIVAVDWRHPR RKGSTLEGSEVRKIITDYAKRNRLVDADNRN - UNI27957 - NLVKLDPILCDCILEKNEQHLVTKLPWDCLLTR - U

NI19750 - RCLKNMQPAYQVTFPGQEPILKKGKLCPIDITLALKTYNKK - UNI15198 - LMDLVLLLFFQDS
Transcript ENSMUST00000086578
Sequence
AGTTCCGGGCCAGCATCAGGGCTAGGGCCGGGTTCCTAGCAGGCTGTTTTTTGGCGCCGAGTCTCAGCATGGCTGCCTCCAGGGTTGAGGGTCCGGGAGC

CGCCACTCCTTCGTTTTGTTGACCGCCCCTGGCGTCTGTGCTCTTCTTGTCTTTCCTGAGCTACTCCAGCAGACATGTTCGCTAAGGCCTTTCGGGTCAA

GTCCAACACAGCCATCAAGGGCTCGGACAG - UNI18985 - GAGAAAGCTCCGGGCCGATGTGACAGCTGCTTTCCCTGCCCTGGGAACAGATCAGA

TCTCTGAATTGATACCTGGAAAGGAAGAGCTAAATGTTGTGAAGTTGTATGTTCACAAAGGGGATTCGGTGACTGTGTACACGAGTGGTGGTAACCCCAT

CCTATTTGAACTGGAGAAAAATTTGTATCCAACAG TGTACACACTGTGGGCCTATCCGGATATTCTACCAACTTTTATAACATGGCCTCTGGTATTGGA

AAAACTGGTCGGGGGAGCAG - UNI16423 - ATTTGATGCTGCCAGGGGTAGTGGTGCCCCCTACTGGTCTTCCTCAAGTACAGCAAGGCGACCTCT

GTGCCATTGCCTTGGTGGGGAACAG - UNI3977 - AGCGCCCGTTGCAATTGGAGTGGCCGCCATGTCCACAGCTCAGATGCTGGCTTCAGGCCTGA

AGGGAAAAGGTGTCTCTGTGCTCCACACTTATCAGGACCACTTGTG - UNI27865 - GAGATCTGGAGACAAGTCCTCTCCACCTGCCATTGCCCCA

CTGGACCCCACAGATAGCTGCGAAGAGAAGGTGCACCTTGGTCTGCAGGGAAACCTGAAGAGCCTGACCCTGGACGGAGAGGAGGAGAACGGGCAGGTTC

CTCTCCGAGAAGCCTCTGAGGACACCAGCTCCAGGGCCCCGAGCCAGGATTCCTTGGACGGCAAGCCCCTTCAGG AACAAATGGACGATCTGTTACTGC

GGTGCTTCCTTCATGCCCTGAAGAGTCGAGTCAAGAAAGCTGACCTCCCGTTGCTCACCAGCACTCTCCTTGGCAGTCACATGTTCTCCTGCTG - UNI

29750 - TCCTGAAGGACAGCAACTGGATATAAAGAAGTCAAGCTATAAAAAG CTCTCTAAGTTCCTGCAGCACATGCAGCAGGAGCAGATTGTCCAG

GTCAAGGAGCTGAGCAAAGGGGTGGAGAGCATTGTGGCTGTGGACTGGAGGCACCCGAG GATCACGTCTTTCGTCATCCCCGAGCCTTCCCTGACTTCC

CAGACTGTCCAGGAAGTTAGCAGGGAACAGCCCTATCTCCCTCCAGATATAAAATCCCTCTACTGTGTCCCAGCCAACATGACCCAGCTCTTCCTGGAGT

CTGGCCACAA GAAGGGGAGCACCCTTGAGGGCAGTGAGGTCCGAAAGATCATCACGGACTATGCCAAGAGAAACAGACTGGTGGATGCAGACAACAGAA

A - UNI27957 - TCTGGTGAAGTTGGATCCTATCTTATGTGACTGCATCTTAGAGAAAAATGAGCAGCACTTGGTCACGAAGCTCCCATGGGACTGT

CTCCTGACCAG - UNI19750 - GTGTTTGAAAAATATGCAGCCTGCCTACCAAGTAACATTTCCTGGCCAGGAACCCATTCTAAAGAAAGGGAAACT

CTGTCCAATTGATATCACCCTTGCACTGAAGACCTATAATAAAAAG GTGACTGTGGTCCGGAACTTGGAGACCTATGGTCTAGATCCGTGCTCAGTGGC

CGCCATTCTCCAGCAGCGATGTCAGGCAAGCACCATCGTCTCTCCTGCCCCTGGGGCCAAAGACAGTCTGCAGGTGCAGGTCCAGGGAAACCAGATCCAC

CACCTTGGCCAGCTACTGCTTG - UNI15198 - GTGAGAACACTGGGACTCTGCATTTACCAGCTCAATACCCCCATCCCCATGTGCAGAACAAGCC

AGAAATCCCACACCTGTCCTGCTGTGGTCTCCCCGCATCACATGATTCGATCTGA
Translation
MFAKAFRVKSNTAIKGSDR - UNI18985 - RRKLRADVTAAFPALGTDQISELIPGKEELNVVKLYVHKGDSVTVYTSGGNPILFELEKNLYPTV V

YTLWAYPDILPTFITWPLVLEKLVGGAD - UNI16423 - DLMLPGVVVPPTGLPQVQQGDLCAIALVGNR - UNI3977 - RAPVAIGVAAMSTA

QMLASGLKGKGVSVLHTYQDHLW - UNI27865 - WRSGDKSSPPAIAPLDPTDSCEEKVHLGLQGNLKSLTLDGEEENGQVPLREASEDTSSRAPSQ

DSLDGKPLQE EQMDDLLLRCFLHALKSRVKKADLPLLTSTLLGSHMFSCC - UNI29750 - CPEGQQLDIKKSSYKK LSKFLQHMQQEQIVQVKE

LSKGVESIVAVDWRHPR RITSFVIPEPSLTSQTVQEVSREQPYLPPDIKSLYCVPANMTQLFLESGHK KKGSTLEGSEVRKIITDYAKRNRLVDADNR

N - UNI27957 - NLVKLDPILCDCILEKNEQHLVTKLPWDCLLTR - UNI19750 - RCLKNMQPAYQVTFPGQEPILKKGKLCPIDITLALKTY

NKK VTVVRNLETYGLDPCSVAAILQQRCQASTIVSPAPGAKDSLQVQVQGNQIHHLGQLLLG - UNI15198 - GENTGTLHLPAQYPHPHVQNKPE

IPHLSCCGLPASHDSI

For any suggestions or comments, please send an email to unitrap@crg.es