Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026436 (Elk4)
Chromosomal location
Chr 1: 133904184 - 133920469 (+)
Description
ELK4, member of ETS oncogene family Gene [Source:MGI Symbol;Acc:MGI:102853]
RefSeq_dna
NM_007923 
RefSeq_peptide
NP_031949.2 
UniGene
Mm.254233 
MGI
MGI:102853 
Uniprot/SWISSPROT
P41158 
Uniprot/SPTREMBL
A6H693 Q8C6Q0 Q8C9K0 Q99K98 
Human Ortholog
ENSG00000158711 (ELK4)
Omim not available
UniTrap UNI27762
Vector Insertion
Chr 1: 133904518 - 133909602
Public Clones not available
Private Clones OST50088 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21140
Vector Insertion
Chr 1: 133909812 - 133910959
Public Clones not available
Private Clones OST340137 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25677
Vector Insertion
Chr 1: 133920129 - 133920241
Public Clones not available
Private Clones OST170705 (lexicon)
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027696
Sequence
TGAGGAGCGGTGGGCGACAGAGTCTCGCACCGCGTTCAAGGCCGAGGAGTCCCGTGCCCTGCCTG - UNI27762 - GGCTGCCAGTTTGTATGTAAA

CTACCCTGCTATGACGCTTAACTGTCTGGAGGAGAAGTACAAGTTGGACTAGGAACAGATTGATCCCTCCACGTCAGCCTCCTGGCCACCCGAGACTCAC

ATCTTGTCAGAGAAACACAATGGGCTCATTTAGCTGTACATTGAACTGGTGGTCTTCTAAGAGAATGTGATGATAATAAGACTTTAAG - UNI21140 

- CCCATTGCTATGGACAGTGCCATCACTCTGTGGCAGTTCCTTCTCCAGCTCCTGCAGGAGCCTCAGAATGAGCACATGATCTGCTGGACATCTAACAA

TGGGGAGTTCAAGCTTCTGCAGGCGGAGGAGGTGGCTCGTCTTTGGGGGATTCGCAAGAACAAGCCTAATATGAATTATGATAAACTCAGCCGAGCCCTG

CGATACTACTACGTAAAG AACATCATTAAAAAAGTGAATGGTCAGAAGTTTGTGTACAAGTTTGTCTCCTATCCAGAGATTTTGAAAATGGACCCACTG

ACGGTAGGCAGGATTGAGGGAGACTGTGAAGCTTTAAATTCCATTGAAACCAGCAGTTCCAAAGATGTTGAGTATGGAGGAAAGGAGAGGCCACCTCAGC

CTGGAGCCAAGACCTCTAGTCGCAATGACTACATACACTCTGGTTTGTATTCTTCATTTACTCTTAACTCTCTGAACACCTCCAATAAGAAGCTTTTCAA

GTCAATAAAGATAGAGAATCCAGCGGAAAAACTAGCAGAGAAGAAAGCCCAGGAGCCAACACCGTCCGTCATCAAATTTGTGACAACGCCTGCCAAAAAG

CCGCCCATCGAGCCTGTCGCTGCTGCCTTTGCAACGAGCCCTAGTCTTTCTCCATCTTCTGAAGAAACTATCCAAGCTTTGGAGACATTAGTCTCTCCCA

CACTACCTTCCCTGGAAACCCCAGCCTCCATATCCATTCTGGCTACCACCTTTAACCCCACTCCTCCGGTTCCATCCACACCCCTTCCTCTAAAGGAGCC

TCCCAGGACACCTTCTCCACCACTGAGTTCTAACCCAGACATTGACACAGACATTGAGTCAGTGGCTTCTCAGCCAATGGAACTTCCAGAGAACTTATCA

CTGGAGCCTAAAAATGAGGATTCAGCTTTGCCAGAAAAGGACAAAACAAATAACTCATCAAGATCTAAGAAGCCCAAAGGGTTAGAACTGACACCCGCCC

TTGTGGTCACAGGCAGTGACCCCAGCCCCTTGGGGATCCTAAGCCCATCTCTCCCGACAGCGTCTCTTACACCAGCACTCTTTTCACAG ACTCCCATCT

TGCTGACTCCGAGCCCCTTGCTCTCCAGCATCCACTTTTGGAGCACTCTCAGCCCGTTTGCTCCCTTGAGCCCAGCCAGACTGCAAGGTGCTAATACGCT

TTTCCAG - UNI25677 - TTTCCCTCTGTACTCAACAGTCATGGCCCGTTCACTCTGTCAGGCCTGGACGGACCTTCCACTCCGGGCCCATTTTCTC

CAGACCTGCAGAAGACATAACCAGTGCAGTTG
Translation
 - UNI27762 -  - UNI21140 - MDSAITLWQFLLQLLQEPQNEHMICWTSNNGEFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVK NI

IKKVNGQKFVYKFVSYPEILKMDPLTVGRIEGDCEALNSIETSSSKDVEYGGKERPPQPGAKTSSRNDYIHSGLYSSFTLNSLNTSNKKLFKSIKIENPA

EKLAEKKAQEPTPSVIKFVTTPAKKPPIEPVAAAFATSPSLSPSSEETIQALETLVSPTLPSLETPASISILATTFNPTPPVPSTPLPLKEPPRTPSPPL

SSNPDIDTDIESVASQPMELPENLSLEPKNEDSALPEKDKTNNSSRSKKPKGLELTPALVVTGSDPSPLGILSPSLPTASLTPALFSQ TPILLTPSPLL

SSIHFWSTLSPFAPLSPARLQGANTLFQ - UNI25677 - FPSVLNSHGPFTLSGLDGPSTPGPFSPDLQKT
Transcript ENSMUST00000086556
Sequence
GGGGGGGGGGTTTGAGAGTGGCGGAGGCCGCGGAACGACGGGAGACGGCGGCCGTAGTGAAGAACGTCGAGCGCACGCACGGCGAGTGGCAGCTTAACTA

TAGCCACTTCGCCGTCCCGGCCGCGTGTGCGAGGGCGGGGCTCGAGACCTGCGGCAGCGGGAGATGCGGGCGGCTGCGGGCACGCGGCTGGCTCGGCTCG

GCCGCCGCTTTCTCGGGCCCCGGCGCGGGGGTCGCCACTGTTCGCCGCGCGGTCTTTGAGGTCCGAGTGTGAGGAGCGGTGGGCGACAGAGTCTCGCACC

GCGTTCAAGGCCGAGGAGTCCCGTGCCCTGCCTG - UNI21140 - - UNI27762 - CCCATTGCTATGGACAGTGCCATCACTCTGTGGCAGTTC

CTTCTCCAGCTCCTGCAGGAGCCTCAGAATGAGCACATGATCTGCTGGACATCTAACAATGGGGAGTTCAAGCTTCTGCAGGCGGAGGAGGTGGCTCGTC

TTTGGGGGATTCGCAAGAACAAGCCTAATATGAATTATGATAAACTCAGCCGAGCCCTGCGATACTACTACGTAAAG AACATCATTAAAAAAGTGAATG

GTCAGAAGTTTGTGTACAAGTTTGTCTCCTATCCAGAGATTTTGAAAATGGACCCACTGACGGTAGGCAGGATTGAGGGAGACTGTGAAGCTTTAAATTC

CATTGAAACCAGCAGTTCCAAAGATGTTGAGTATGGAGGAAAGGAGAGGCCACCTCAGCCTGGAGCCAAGACCTCTAGTCGCAATGACTACATACACTCT

GGTTTGTATTCTTCATTTACTCTTAACTCTCTGAACACCTCCAATAAGAAGCTTTTCAAGTCAATAAAGATAGAGAATCCAGCGGAAAAACTAGCAGAGA

AGAAAGCCCAGGAGCCAACACCGTCCGTCATCAAATTTGTGACAACGCCTGCCAAAAAGCCGCCCATCGAGCCTGTCGCTGCTGCCTTTGCAACGAGCCC

TAGTCTTTCTCCATCTTCTGAAGAAACTATCCAAGCTTTGGAGACATTAGTCTCTCCCACACTACCTTCCCTGGAAACCCCAGCCTCCATATCCATTCTG

GCTACCACCTTTAACCCCACTCCTCCGGTTCCATCCACACCCCTTCCTCTAAAGGAGCCTCCCAGGACACCTTCTCCACCACTGAGTTCTAACCCAGACA

TTGACACAGACATTGAGTCAGTGGCTTCTCAGCCAATGGAACTTCCAGAGAACTTATCACTGGAGCCTAAAAATGAGGATTCAGCTTTGCCAGAAAAGGA

CAAAACAAATAACTCATCAAGATCTAAGAAGCCCAAAGGGTTAGAACTGACACCCGCCCTTGTGGTCACAGGCAGTGACCCCAGCCCCTTGGGGATCCTA

AGCCCATCTCTCCCGACAGCGTCTCTTACACCAGCACTCTTTTCACAG ACTCCCATCTTGCTGACTCCGAGCCCCTTGCTCTCCAGCATCCACTTTTGG

AGCACTCTCAGCCCGTTTGCTCCCTTGAGCCCAGCCAGACTGCAAGGTGCTAATACGCTTTTCCAG - UNI25677 - TTTCCCTCTGTACTCAACAG

TCATGGCCCGTTCACTCTGTCAGGCCTGGACGGACCTTCCACTCCGGGCCCATTTTCTCCAGACCTGCAGAAGACATAACCAGTGCAGTTGTGGACTGAG

AGACCAAGGGACTAGGAAACAGACACCCGCCATGACTCGGTTCGAAATGAGGGCTCGTCTGCAGTGCTCGTGATTTTCCCACTGCCTGTCGCCAGGCCTT

GAGGACTCTGTACAGAAAATGCCTTAATTGGAGTCCAAGCTCCACCTCACTTCTTTTTTTAAAAAGGTGTTTTTTTGTTGTTGTTTTTGCTTTTTTTTTT

TTTTTTTTTTAGCTTTGTGC
Translation
 - UNI21140 - - UNI27762 - MDSAITLWQFLLQLLQEPQNEHMICWTSNNGEFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVK NII

KKVNGQKFVYKFVSYPEILKMDPLTVGRIEGDCEALNSIETSSSKDVEYGGKERPPQPGAKTSSRNDYIHSGLYSSFTLNSLNTSNKKLFKSIKIENPAE

KLAEKKAQEPTPSVIKFVTTPAKKPPIEPVAAAFATSPSLSPSSEETIQALETLVSPTLPSLETPASISILATTFNPTPPVPSTPLPLKEPPRTPSPPLS

SNPDIDTDIESVASQPMELPENLSLEPKNEDSALPEKDKTNNSSRSKKPKGLELTPALVVTGSDPSPLGILSPSLPTASLTPALFSQ TPILLTPSPLLS

SIHFWSTLSPFAPLSPARLQGANTLFQ - UNI25677 - FPSVLNSHGPFTLSGLDGPSTPGPFSPDLQKT

For any suggestions or comments, please send an email to unitrap@crg.es