Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026455 (Klhl12)
Chromosomal location
Chr 1: 136352108 - 136387595 (+)
Description
kelch-like 12 (Drosophila) Gene [Source:MGI (curated);Acc:Klhl12-002]
RefSeq_dna
NM_153128 
RefSeq_peptide
NP_694768.1 
UniGene
Mm.87398 Mm.472069 
MGI
MGI:2385619 
Uniprot/SWISSPROT
Q8BZM0 
Human Ortholog
ENSG00000117153 (KLHL12)
Omim not available
UniTrap UNI33447
Vector Insertion
Chr 1: 136352243 - 136355004
Public Clones IST14131D11 (tigm) IST13785G6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1756
Vector Insertion
Chr 1: 136364446 - 136368970
Public Clones CF0428 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7942
Vector Insertion
Chr 1: 136369121 - 136372364
Public Clones RRJ388 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36344
Vector Insertion
Chr 1: 136372480 - 136380323
Public Clones IST13435C1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36847
Vector Insertion
Chr 1: 136382491 - 136383586
Public Clones IST10076G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027725
Sequence
GTACTCCGAGACTGGAGTTTACCACGGAGACTGCTCCGCAGCGGCTGGTCCGGGCGGCAGCGGCGGCGCTCCGGCTGCTCAGCCGCCTGGGAGCCCGGCG

CCTAGCACCTCGGCTCGGACGGCCCAGGAGCCCTG - UNI33447 - TGCTTGATGGGCGGCATTATGGCCCCTAAAGACATAATGACAAACACTCAC

GCTAAGTCCATCCTCAACTCCATGAACTCCCTCAGGAAGAGCAACACCCTCTGTGATGTGACCTTGAGAGTGGAGCAGAAAGACTTCCCTGCGCATCGGA

TTGTGCTGGCCGCCTGCAGTGATTATTTCTGTGCCATGTTCACTAGTGAG CTTTCAGAGAAGGGGAAGCCGTATGTTGACATTCAAGGTTTAACTGCTG

CTACCATGGAGATCCTGCTGGACTTCGTGTACACAGAAACAGTACATGTGACAGTGGAGAATGTTCAAGAACTGCTCCCTGCAGCCTGTCTTCTTCAGCT

GAAAG GTGTGAAACAAGCCTGCTGTGAGTTCTTAGAAAGTCAGCTGGATCCATCTAATTGCCTGGGTATCAGGGATTTTGCTGAAACTCACAATTGCGT

TGACCTGATGCAAGCAGCTGAGGTGTTTAGCCAGAAGCATTTTCCTGAAGTGGTGCAGCACGAGGAGTTCATTCTTCTGAGTCAAGGGGAGGTGGAGAAG

CTAATCAAGTGCGACGAGATTCAG - UNI1756 - GTGGATTCTGAAGAGCCAGTCTTTGAGGCTGTTATCAACTGGGTGAAGCATGCCAAGAAGGAG

CGAGAAGAGTCTTTACCTGACCTCTTACAGTATGTTCGGATGCCCCTGCTGACCCCCAGGTACATTACAGATGTAATTGATGCTGAG - UNI7942 - 

CCTTTCATCCGCTGTAGTTTACAATGCAGAGATCTAGTTGATGAAGCAAAGAAGTTTCACCTGAGGCCTGAACTTCGGAGTCAGATGCAAGGACCCAGAA

CAAGGGCCCGGCTAG - UNI36344 - GAGCCAATGAAGTGCTTCTGGTGGTTGGGGGCTTCGGAAGCCAGCAGTCTCCTATTGATGTGGTAGAGAAG

TATGACCCCAAGACACAGGAGTGGAGCTTTTTACCA AGTATCACTCGCAAGAGACGGTATGTGGCCTCAGTTTCCTTACATGATCGGATCTATGTAATT

GGTGGCTACGATGGCCGTTCCCGCCTCAGTTCGGTGGAATGTCTAGACTATACAGCAGACGAAGATGGAGTGTGGTACTCTGTGGCCCCTATGAATGTGC

GGCGAGGCCTTGCTGGAGCCACCACTCTGGGAG - UNI36847 - ATATGATTTACGTCTCTGGAGGCTTTGATGGAAGTAGGCGTCATACAAGTATG

GAGCGGTATGACCCAAACATCGATCAGTGGAGTATGCTGGGAGATATGCAGACAGCTCGAGAGGGCGCAGGACTAGTAGTGGCCAGCGGAATAATCTATT

GTCTAG GAGGATATGATGGCTTGAACATATTAAATTCAGTTGAGAAATATGATCCCCATACAGGACACTGGACTAACGTTACGCCTATGGCCACCAAGC

GTTCTG GTGCTGGAGTAGCCCTACTGAATGACCATATTTATGTGGTGGGGGGGTTTGATGGTACAGCCCACCTTTCTTCTGTTGAAGCTTATAACATTC

GCACTGATTCCTGGACAACTGTCACAAGTATGACCACGCCTCGATGCTATGTAGGGGCCACAGTGCTTCGAGGGAGACTCTATGCAATTGCAGG ATACG

ATGGGAATTCTCTGCTGAGCAGCATTGAGTGTTATGACCCTATCATCGACAGCTGGGAAGTAGTAGCCTCCATGGGAACCCAGCGTTGTGATGCTGGTGT

GTGTGTTCTCCGAGAAAAGTAACTGTTATTTTAACACCAGCTGGAGCCAGTGACTACTCCAAGGAACAGTTTGTGGGAGAATCAAGGATCCTTTCCAGAA

TGTTTATTCCTCACTGTGTGCACAGGGGGATTCCAGGCACCAGTGCTGAGATGATGATTGTACTTGTTTGATGCACACTCTCCTTCGCACTGGTCATCTT

GCTCAGAAGCATGGGGGGGGGCAGGTACTCCAGGGAAGAGAATGCACGTTTGGATGTGGGAAACCAGATCATGGCTCTCTGTGGTCTGAGGAGCACTTTC

TTACTGTTTCTAACTTACCATGTGCTTGGGAGGATGTATGTATGTATGTTTGTATGGATGTATGTTGTGCCTCATATATTGCAGAGAATAAGGTGAGTAT

GGCCTGCTAGATGTGGGCAGTGTCCATCCTAGGTGATTGGAAGGATATCAGTTTATACAAGCTTGGTAAAATGAAAGTCTTTTTCCCTCTCAGAAGCAAA

AATACCTTTTCTAAATACAGAGGTAGCTCAAGCCACCACAGTTCCTTGCTGTAGGAAAACACTATCACTGTTAAAATTTGAGAGGCCAAGAAGGAAGATT

CATGCTGTCCTCACTTAGGAAGACATTGTTGGTGCAGAGATTTGAATAAGTGGCTGGAGCTGAATGGAATGTAGGTGAACCCAGAAGATCACTGAAGTGT

AAATTGGAAGGCTGGAAAGGACATGTTATTTGATTTCACAGTCTTTCTAATGTAAAATGTTGTACCATCTTGGCACTGGAGACTTGAGAGATTAACAGTG

GAAAAGGTTAGAATAAGAGATGCTGTAAATGTGCAGAGTTCAATATACCTGTGGTAAACTAGAAATATCTGTGATTTTACAATTGTCTTAGTCCCTGCCA

GGGCTCCTATAGCAGTGGCAGTTTGGTCTTCAAATGGGTGAAAAGACCATCTTCCTGGCGAATCAAGTGCTACCACGTTACTACGCCTCCACACTATTTA

TTTGGGGATGGGTGGGGTGGCTGCAGCCTAGTAGTTCAGGTACGTGATTACTGCCCTGTTGTTTAGGGCACACTTCCACTAAGGAGTGCTTAAGACTGCT

GTGTGTGGTATGTTCAGTTTTCTTCCTGCTATATCTTCTGTACCTGTCTTTACAGTGTATTTTACTCATCCTGAAACAAAATAATCAAGGACAATTGAAA

ATCTTTTGTTAGTTTCTATACCTTCGTATAGAATGGCAGTTCTAGGCACCTCTGTGTCGTGGTGAAACTCTTGAGTTACTGGTATAGCAAATAGGAGAAT

GTGGCAGCCTAAACTGGGCTACACTTTCCTTTTGCTCTGGAATCCCACTTTTCCTCTTTCCTTGAATTGTGTTTGCTGACAGAGTTAATTTCCTTTGTAT

TTTTTTAAGAAAACATTAAAATGGACTGTCTCAAATGGCTTTAAGAGAATTTGTGGGTAGTGCTGCCTTCAGCAGACATGTTGAAGGACATCTAAGCTCA

AGGTCTTTCATCTACCCTGTTTACCTTATGCCTGCCAACAAGCTCAGCTGCTTCTCTGGCAGCATCAGTAAAATGTTTGCCC
Translation
 - UNI33447 - MGGIMAPKDIMTNTHAKSILNSMNSLRKSNTLCDVTLRVEQKDFPAHRIVLAACSDYFCAMFTSE LSEKGKPYVDIQGLTAATME

ILLDFVYTETVHVTVENVQELLPAACLLQLKG GVKQACCEFLESQLDPSNCLGIRDFAETHNCVDLMQAAEVFSQKHFPEVVQHEEFILLSQGEVEKLI

KCDEIQ - UNI1756 - VDSEEPVFEAVINWVKHAKKEREESLPDLLQYVRMPLLTPRYITDVIDAE - UNI7942 - PFIRCSLQCRDLVDEAKK

FHLRPELRSQMQGPRTRARLG - UNI36344 - GANEVLLVVGGFGSQQSPIDVVEKYDPKTQEWSFLP SITRKRRYVASVSLHDRIYVIGGYDGRS

RLSSVECLDYTADEDGVWYSVAPMNVRRGLAGATTLGD - UNI36847 - DMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASG

IIYCLG GGYDGLNILNSVEKYDPHTGHWTNVTPMATKRSG GAGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRL

YAIAG GYDGNSLLSSIECYDPIIDSWEVVASMGTQRCDAGVCVLREK
Transcript ENSMUST00000112232
Sequence
GTACTCCGAGACTGGAGTTTACCACGGAGACTGCTCCGCAGCGGCTGGTCCGGGCGGCAGCGGCGGCGCTCCGGCTGCTCAGCCGCCTGGGAGCCCGGCG

CCTAGCACCTCGGCTCGGACGGCCCAGGAGCCCTG - UNI33447 - CCACATTGTCCAAGGACTCCTTTGTTCTTTCTCCTTAGTGCTTGATGGGCG

GCATTATGGCCCCTAAAGACATAATGACAAACACTCACGCTAAGTCCATCCTCAACTCCATGAACTCCCTCAGGAAGAGCAACACCCTCTGTGATGTGAC

CTTGAGAGTGGAGCAGAAAGACTTCCCTGCGCATCGGATTGTGCTGGCCGCCTGCAGTGATTATTTCTGTGCCATGTTCACTAGTGAG CTTTCAGAGAA

GGGGAAGCCGTATGTTGACATTCAAGGTTTAACTGCTGCTACCATGGAGATCCTGCTGGACTTCGTGTACACAGAAACAGTACATGTGACAGTGGAGAAT

GTTCAAGAACTGCTCCCTGCAGCCTGTCTTCTTCAGCTGAAAG GTGTGAAACAAGCCTGCTGTGAGTTCTTAGAAAGTCAGCTGGATCCATCTAATTGC

CTGGGTATCAGGGATTTTGCTGAAACTCACAATTGCGTTGACCTGATGCAAGCAGCTGAGGTGTTTAGCCAGAAGCATTTTCCTGAAGTGGTGCAGCACG

AGGAGTTCATTCTTCTGAGTCAAGGGGAGGTGGAGAAGCTAATCAAGTGCGACGAGATTCAG - UNI1756 - GTGGATTCTGAAGAGCCAGTCTTTG

AGGCTGTTATCAACTGGGTGAAGCATGCCAAGAAGGAGCGAGAAGAGTCTTTACCTGACCTCTTACAGTATGTTCGGATGCCCCTGCTGACCCCCAGGTA

CATTACAGATGTAATTGATGCTGAG - UNI7942 - CCTTTCATCCGCTGTAGTTTACAATGCAGAGATCTAGTTGATGAAGCAAAGAAGTTTCACCT

GAGGCCTGAACTTCGGAGTCAGATGCAAGGACCCAGAACAAGGGCCCGGCTAG - UNI36344 - GAGCCAATGAAGTGCTTCTGGTGGTTGGGGGCT

TCGGAAGCCAGCAGTCTCCTATTGATGTGGTAGAGAAGTATGACCCCAAGACACAGGAGTGGAGCTTTTTACCA AGTATCACTCGCAAGAGACGGTATG

TGGCCTCAGTTTCCTTACATGATCGGATCTATGTAATTGGTGGCTACGATGGCCGTTCCCGCCTCAGTTCGGTGGAATGTCTAGACTATACAGCAGACGA

AGATGGAGTGTGGTACTCTGTGGCCCCTATGAATGTGCGGCGAGGCCTTGCTGGAGCCACCACTCTGGGAG - UNI36847 - ATATGATTTACGTCT

CTGGAGGCTTTGATGGAAGTAGGCGTCATACAAGTATGGAGCGGTATGACCCAAACATCGATCAGTGGAGTATGCTGGGAGATATGCAGACAGCTCGAGA

GGGCGCAGGACTAGTAGTGGCCAGCGGAATAATCTATTGTCTAG GAGGATATGATGGCTTGAACATATTAAATTCAGTTGAGAAATATGATCCCCATAC

AGGACACTGGACTAACGTTACGCCTATGGCCACCAAGCGTTCTG CTTATAACATTCGCACTGATTCCTGGACAACTGTCACAAGTATGACCACGCCTCG

ATGCTATGTAGGGGCCACAGTGCTTCGAGGGAGACTCTATGCAATTGCAGG ATACGATGGGAATTCTCTGCTGAGCAGCATTGAGTGTTATGACCCTAT

CATCGACAGCTGGGAAGTAGTAGCCTCCATGGGAACCCAGCGTTGTGATGCTGGTGTGTGTGTTCTCCGAGAAAAGTAACTGTTATTTTAACACCAGCTG

GAGCCAGTGACTACTCCAAGGAACAGTTTGTGGGAGAATCAAGGATCCTTTCCAGAATGTTTATTCCTCACTGTGTGCACAGGGGGATTCCAGGCACCAG

TGCTGAGATGATGATTGTACTTGTTTGATGCACACTCTCCTTCGCACTGGTCATCTTGCTCAGAAGCATGGGGGGGGGCAGGTACTCCAGGGAAGAGAAT

GCACGTTTGGATGTGGGAAACCAGATCATGGCTCTCTGTGGTCTGAGGAGCACTTTCTTACTGTTTCTAACTTACCATGTGCTTGGGAGGATGTATGTAT

GTATGTTTGTATGGATGTATGTTGTGCCTCATATATTGCAGAGAATAAGGTGAGTATGGCCTGCTAGATGTGGGCAGTGTCCATCCTAGGTGATTGGAAG

GATATCAGTTTATACAAGCTTGGTAAAATGAAAGTCTTTTTCCCTCTCAGAAGCAAAAATACCTTTTCTAAATACAGAGGTAGCTCAAGCCACCACAGTT

CCTTGCTGTAGGAAAACACTATCACTGTTAAAATTTGAGAGGCCAAGAAGGAAGATTCATGCTGTCCTCACTTAGGAAGACATTGTTGGTGCAGAGATTT

GAATAAGTGGCTGGAGCTGAATGGAATGTAGGTGAACCCAGAAGATCACTGAAGTGTAAATTGGAAGGCTGGAAAGGACATGTTATTTGATTTCACAGTC

TTTCTAATGTAAAATGTTGTACCATCTTGGCACTGGAGACTTGAGAGATTAACAGTGGAAAAGGTTAGAATAAGAGATGCTGTAAATGTGCAGAGTTCAA

TATACCTGTGGTAAACTAGAAATATCTGTGATTTTACAATTGTCTTAGTCCCTGCCAGGGCTCCTATAGCAGTGGCAGTTTGGTCTTCAAATGGGTGAAA

AGACCATCTTCCTGGCGAATCAAGTGCTACCACGTTACTACGCCTCCACACTATTTATTTGGGGATGGGTGGGGTGGCTGCAGCCTAGTAGTTCAGGTAC

GTGATTACTGCCCTGTTGTTTAGGGCACACTTCCACTAAGGAGTGCTTAAGACTGCTGTGTGTGGTATGTTCAGTTTTCTTCCTGCTATATCTTCTGTAC

CTGTCTTTACAGTGTATTTTACTCATCCTGAAACAAAATAATCAAGGACAATTGAAAATCTTTTGTTAGTTTCTATACCTTCGTATAGAATGGCAGTTCT

AGGCACCTCTGTGTCGTGGTGAAACTCTTGAGTTACTGGTATAGCAAATAGGAGAATGTGGCAGCCTAAACTGGGCTACACTTTCCTTTTGCTCTGGAAT

CCCACTTTTCCTCTTTCCTTGAATTGTGTTTGCTGACAGAGTTAATTTCCTTTGTATTTTTTTAAGAAAACATTAAAATGGACTGTCTCAAATG
Translation
 - UNI33447 - MGGIMAPKDIMTNTHAKSILNSMNSLRKSNTLCDVTLRVEQKDFPAHRIVLAACSDYFCAMFTSE LSEKGKPYVDIQGLTAATME

ILLDFVYTETVHVTVENVQELLPAACLLQLKG GVKQACCEFLESQLDPSNCLGIRDFAETHNCVDLMQAAEVFSQKHFPEVVQHEEFILLSQGEVEKLI

KCDEIQ - UNI1756 - VDSEEPVFEAVINWVKHAKKEREESLPDLLQYVRMPLLTPRYITDVIDAE - UNI7942 - PFIRCSLQCRDLVDEAKK

FHLRPELRSQMQGPRTRARLG - UNI36344 - GANEVLLVVGGFGSQQSPIDVVEKYDPKTQEWSFLP SITRKRRYVASVSLHDRIYVIGGYDGRS

RLSSVECLDYTADEDGVWYSVAPMNVRRGLAGATTLGD - UNI36847 - DMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASG

IIYCLG GGYDGLNILNSVEKYDPHTGHWTNVTPMATKRSA AYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAG GYDGNSLLSSIECYDPIIDSW

EVVASMGTQRCDAGVCVLREK
Transcript ENSMUST00000116528
Sequence
CGGAGACTGCTCCGCAGCGGCTGGTCCGGGCGGCAGCGGCGGCGCTCCGGCTGCTCAGCCGCCTGGGAGCCCGGCGCCTAGCACCTCGGCTCGGACGGCC

CAGGAGCCCTG - UNI33447 - CCACATTGTCCAAGGACTCCTTTGTTCTTTCTCCTTAGTGCTTGATGGGCGGCATTATGGCCCCTAAAGACATAA

TGACAAACACTCACGCTAAGTCCATCCTCAACTCCATGAACTCCCTCAGGAAGAGCAACACCCTCTGTGATGTGACCTTGAGAGTGGAGCAGAAAGACTT

CCCTGCGCATCGGATTGTGCTGGCCGCCTGCAGTGATTATTTCTGTGCCATGTTCACTAGTGAG CTTTCAGAGAAGGGGAAGCCGTATGTTGACATTCA

AGGTTTAACTGCTGCTACCATGGAGATCCTGCTGGACTTCGTGTACACAGAAACAGTACATGTGACAGTGGAGAATGTTCAAGAACTGCTCCCTGCAGCC

TGTCTTCTTCAGCTGAAAG GTGTGAAACAAGCCTGCTGTGAGTTCTTAGAAAGTCAGCTGGATCCATCTAATTGCCTGGGTATCAGGGATTTTGCTGAA

ACTCACAATTGCGTTGACCTGATGCAAGCAGCTGAGGTGTTTAGCCAGAAGCATTTTCCTGAAGTGGTGCAGCACGAGGAGTTCATTCTTCTGAGTCAAG

GGGAGGTGGAGAAGCTAATCAAGTGCGACGAGATTCAG - UNI1756 - GTGGATTCTGAAGAGCCAGTCTTTGAGGCTGTTATCAACTGGGTGAAGC

ATGCCAAGAAGGAGCGAGAAGAGTCTTTACCTGACCTCTTACAGTATGTTCGGATGCCCCTGCTGACCCCCAGGTACATTACAGATGTAATTGATGCTGA

G - UNI7942 - CCTTTCATCCGCTGTAGTTTACAATGCAGAGATCTAGTTGATGAAGCAAAGAAGTTTCACCTGAGGCCTGAACTTCGGAGTCAGAT

GCAAGGACCCAGAACAAGGGCCCGGCTAG - UNI36344 - GAGCCAATGAAGTGCTTCTGGTGGTTGGGGGCTTCGGAAGCCAGCAGTCTCCTATTG

ATGTGGTAGAGAAGTATGACCCCAAGACACAGGAGTGGAGCTTTTTACCA AGTATCACTCGCAAGAGACGGTATGTGGCCTCAGTTTCCTTACATGATC

GGATCTATGTAATTGGTGGCTACGATGGCCGTTCCCGCCTCAGTTCGGTGGAATGTCTAGACTATACAGCAGACGAAGATGGAGTGTGGTACTCTGTGGC

CCCTATGAATGTGCGGCGAGGCCTTGCTGGAGCCACCACTCTGGGAG - UNI36847 - ATATGATTTACGTCTCTGGAGGCTTTGATGGAAGTAGGC

GTCATACAAGTATGGAGCGGTATGACCCAAACATCGATCAGTGGAGTATGCTGGGAGATATGCAGACAGCTCGAGAGGGCGCAGGACTAGTAGTGGCCAG

CGGAATAATCTATTGTCTAG GAGGATATGATGGCTTGAACATATTAAATTCAGTTGAGAAATATGATCCCCATACAGGACACTGGACTAACGTTACGCC

TATGGCCACCAAGCGTTCTG GTGCTGGAGTAGCCCTACTGAATGACCATATTTATGTGGTGGGGGGGTTTGATGGTACAGCCCACCTTTCTTCTGTTGA

AGCTTATAACATTCGCACTGATTCCTGGACAACTGTCACAAGTATGACCACGCCTCGATGCTATGTAGGGGCCACAGTGCTTCGAGGGAGACTCTATGCA

ATTGCAGG ATACGATGGGAATTCTCTGCTGAGCAGCATTGAGTGTTATGACCCTATCATCGACAGCTGGGAAGTAGTAGCCTCCATGGGAACCCAGCGT

TGTGATGCTGGTGTGTGTGTTCTCCGAGAAAAGTAACTGTTATTTTAACACCAGCTGGAGCCAGTGACTACTCCAAGGAACAGTTTGTGGGAGAATCAAG

GATCCTTTCCAGAATGTTTATTCCTCACTGTGTGCACAGGGGGATTCCAGGCACCAGTGCTGAGATGATGATTGTACTTGTTTGATGCACACTCTCCTTC

GCACTGGTCATCTTGCTCAGAAGCATGGGGGGGGGCAGGTACTCCAGGGAAGAGAATGCACGTTTGGATGTGGGAAACCAGATCATGGCTCTCTGTGGTC

TGAGGAGCACTTTCTTACTGTTTCTAACTTACCATGTGCTTGGGAGGATGTATGTATGTATGTTTGTATGGATGTATGTTGTGCCTCATATATTGCAGAG

AATAAGGTGAGTATGGCCTGCTAGATGTGGGCAGTGTCCATCCTAGGTGATTGGAAGGATATCAGTTTATACAAGCTTGGTAAAATGAAAGTCTTTTTCC

CTCTCAGAAGCAAAAATACCTTTTCTAAATACAGAGGTAGCTCAAGCCACCACAGTTCCTTGCTGTAGGAAAACACTATCACTGTTAAAATTTGAGAGGC

CAAGAAGGAAGATTCATGCTGTCCTCACTTAGGAAGACATTGTTGGTGCAGAGATTTGAATAAGTGGCTGGAGCTGAATGGAATGTAGGTGAACCCAGAA

GATCACTGAAGTGTAAATTGGAAGGCTGGAAAGGACATGTTATTTGATTTCACAGTCTTTCTAATGTAAAATGTTGTACCATCTTGGCACTGGAGACTTG

AGAGATTAACAGTGGAAAAGGTTAGAATAAGAGATGCTGTAAATGTGCAGAGTTCAATATACCTGTGGTAAACTAGAAATATCTGTGATTTTACAATTGT

CTTAGTCCCTGCCAGGGCTCCTATAGCAGTGGCAGTTTGGTCTTCAAATGGGTGAAAAGACCATCTTCCTGGCGAATCAAGTGCTACCACGTTACTACGC

CTCCACACTATTTATTTGGGGATGGGTGGGGTGGCTGCAGCCTAGTAGTTCAGGTACGTGATTACTGCCCTGTTGTTTAGGGCACACTTCCACTAAGGAG

TGCTTAAGACTGCTGTGTGTGGTATGTTCAGTTTTCTTCCTGCTATATCTTCTGTACCTGTCTTTACAGTGTATTTTACTCATCCTGAAACAAAATAATC

AAGGACAATTGAAAATCTTTTGTTAGTTTCTATACCTTCGTATAGAATGGCAGTTCTAGGCACCTCTGTGTCGTGGTGAAACTCTTGAGTTACTGGTATA

GCAAATAGGAGAATGTGGCAGCCTAAACTGGGCTACACTTTCCTTTTGCTCTGGAATCCCACTTTTCCTCTTTCCTTGAATTGTGTTTGCTGACAGAGTT

AATTTCCTTTGTATTTTTTTAAGAAAACATTAAAATGGACTGTCTCAAATG
Translation
 - UNI33447 - MGGIMAPKDIMTNTHAKSILNSMNSLRKSNTLCDVTLRVEQKDFPAHRIVLAACSDYFCAMFTSE LSEKGKPYVDIQGLTAATME

ILLDFVYTETVHVTVENVQELLPAACLLQLKG GVKQACCEFLESQLDPSNCLGIRDFAETHNCVDLMQAAEVFSQKHFPEVVQHEEFILLSQGEVEKLI

KCDEIQ - UNI1756 - VDSEEPVFEAVINWVKHAKKEREESLPDLLQYVRMPLLTPRYITDVIDAE - UNI7942 - PFIRCSLQCRDLVDEAKK

FHLRPELRSQMQGPRTRARLG - UNI36344 - GANEVLLVVGGFGSQQSPIDVVEKYDPKTQEWSFLP SITRKRRYVASVSLHDRIYVIGGYDGRS

RLSSVECLDYTADEDGVWYSVAPMNVRRGLAGATTLGD - UNI36847 - DMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASG

IIYCLG GGYDGLNILNSVEKYDPHTGHWTNVTPMATKRSG GAGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRL

YAIAG GYDGNSLLSSIECYDPIIDSWEVVASMGTQRCDAGVCVLREK

For any suggestions or comments, please send an email to unitrap@crg.es