Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026496 (Parp1)
Chromosomal location
Chr 1: 182499055 - 182531130 (+)
Description
poly (ADP-ribose) polymerase family, member 1 Gene [Source:MGI Symbol;Acc:MGI:1340806]
RefSeq_dna
NM_007415 
RefSeq_peptide
NP_031441.2 
UniGene
Mm.277779 
MGI
MGI:1340806 
Uniprot/SWISSPROT
P11103 
Uniprot/SPTREMBL
Q3TF18 Q3TIV3 Q3TM68 Q3TX36 Q3U868 Q3UJ03 Q3UX06 Q921K2 
Human Ortholog
ENSG00000143799 (PARP1)
Omim not available
UniTrap UNI7195
Vector Insertion
Chr 1: 182499285 - 182503782
Public Clones (sanger) RRU496 (baygenomics) E123A11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7338
Vector Insertion
Chr 1: 182514038 - 182515973
Public Clones PT058 (baygenomics) RRU099 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15242
Vector Insertion
Chr 1: 182516122 - 182517391
Public Clones PST10846-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15749
Vector Insertion
Chr 1: 182517533 - 182518051
Public Clones PST1740-1 (escells)
Private Clones not available
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15329
Vector Insertion
Chr 1: 182518559 - 182518780
Public Clones PST3932-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4753
Vector Insertion
Chr 1: 182521478 - 182522978
Public Clones AX0197 (sanger) PST17761-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8282
Vector Insertion
Chr 1: 182527520 - 182528341
Public Clones RRF181 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027777
Sequence
AGTAATCTATCCTGAGCGGAGGCGGCTCTGCACGCTTGCGGGGGAAACCGACACGTTAGCGGAGCGCACCAGCGGCGGCGTCGGGCTGCCGCTGCAGCAC

GAGAAGGAGGATGGCGGAGGCCTCGGAGAGGCTTTATCGAGTGGAGTACGCGAAGAGCGGGCGCGCCTCTTGCAAGAAATGCAGCGAGAGTATTCCCAAG

GACTCCCTCCGCATGGCCATCATGGTGCAG - UNI7195 - TCACCCATGTTCGATGGGAAAGTCCCACACTGGTACCACTTCTCCTGCTTCTGGAAG

GTGGGCCACTCCATCCGGCAGCCTGATGTTGAGGTGGATGGCTTCTCTGAGCTGCGCTGGGATGATCAGCAGAAGGTCAAGAAGACGGCCGAGGCTGGAG

GCGTGGCAG GCAAAGGCCAGGATGGAAGTGGCGGCAAGGCGGAGAAGACATTGGGTGACTTTTTAGCGGAGTACGCCAAGTCCAACAGGAGCATGTGCA

AGGGCTGCCTGGAGAAGATAGAGAAG GGCCAGATGCGCCTGTCCAAGAAGATGGTGGATCCAGAGAAGCCACAGCTGGGTATGATTGACCGCTGGTACC

ATCCAACTTGCTTTGTCAAGAAGCGGGACGAGCTGGGCTTCCGGCCTGAGTACAGTGCCAGTCAGCTCAAGGGCTTTAGCCTCCTCTCTGCAGAAGACAA

AGAAGCTCTGAAGAAGCAGCTCCCGGCCATCAAGAATGAAGG AAAGAGAAAAGGTGACGAGGTGGATGGAACAGATGAAGTGGCCAAAAAGAAATCTAA

GAAAGGGAAGGACAAGGATAGTAGTAAGCTGGAGAAGGCCCTCAAG GCTCAGAATGAGCTGATCTGGAATATCAAAGACGAGCTGAAGAAAGCGTGTTC

CACCAACGACCTGAAGGAGCTGCTCATCTTCAACCAGCAGCAGGTGCCGTCAGGAGAGTCAGCG ATCTTGGACAGAGTTGCTGACGGCATGGCGTTTGG

GGCCCTTCTGCCCTGCAAGGAGTGTTCAGGCCAGCTGGTCTTTAAGAGCGACGCTTATTACTGTACTGGGGATGTCACTGCCTGGACCAAGTGCATGGTC

AAGACACAGAATCCTAGCCGAAAGGAATGGGTAACTCCAAAG - UNI7338 - GAATTCCGAGAAATATCCTACCTCAAGAAGTTAAAGGTCAAAAAA

CAGGACCGAATATTCCCTCCAGAAAGCAGCGCCCCAGCACCACTGGCACTGCCCCTCTCTGTCACCTCAGCACCCACAGCTGTGAACTCCTCTGCTCCAG

CAG - UNI15242 - ACAAGCCCCTGTCTAACATGAAGATCCTGACTCTTGGGAAGCTCTCCCAGAACAAGGACGAAGCAAAAGCTGTGATTGAGAAA

CTCGGAGGCAAGTTGACAGGATCTGCCAACAAGGCCTCCTTGTGTATCAGCACTAAAA - UNI15749 - AGGAGGTGGAGAAGATGAGTAAGAAGAT

GGAGGAAGTGAAAGCGGCCAACGTTCGAGTTGTGTGTGAGGACTTCCTCCAGGACGTGTCTGCCTCCACTAAAAGCCTCCAAGAGCTGCTCTCGGCCCAC

AGCTTGTCCTCGTGGGGGGCTGAGGTGAAGGCAGAGCCTGGTGAAGTGGTGGCCCCCAAGGGGAAGTCAGCTGCACCCTCCAAGAAGAGCAAGGGTGCTG

TCAAGGAGGAAG GTGTCAACAAATCTGAAAAGAGGATGAAATTAACTCTGAAGGGAGGAGCAGCCGTTGATCCTGACTCTG - UNI15329 - GTCT

GGAACACTCTGCACACGTCCTGGAGAAAGGTGGGAAGGTGTTCAGCGCCACACTTGGCCTGGTGGACATTGTGAAAGGGACGAACTCCTATTACAAACTG

CAGCTTCTGGAGGACGACAAGGAGAGCAG GTACTGGATCTTCCGGTCCTGGGGCCGGGTGGGCACAGTTATCGGCAGTAACAAACTTGAGCAGATGCCC

TCCAAAGAGGACGCTGTTGAGCACTTCATGAAGCTGTATGAAGAGAAGACTGGGAATGCCTGGCACTCGAAAAACTTCACAAAGTATCCCAAGAAGTTCT

ACCCTCTGGAGATTGACTATGGCCAG GACGAAGAGGCAGTAAAGAAGCTGACGGTGAAGCCTGGCACCAAGTCGAAGCTGCCGAAGCCAGTGCAGGAGC

TCGTGGGGATGATCTTCGACGTGGAGAGCATGAAAAAGGCCTTGGTGGAGTACGAG - UNI4753 - ATTGACCTCCAGAAGATGCCCTTGGGGAAGC

TGAGCAGAAGGCAGATCCAGGCCGCCTACTCTATCCTCAGCGAGGTCCAGCAG GCAGTGTCTCAAGGCAGCAGTGAATCCCAGATCCTAGATCTCTCCA

ATCGCTTCTACACTCTGATCCCCCATGACTTTGGAATGAAGAAGCCCCCACTCCTGAACAACGCAGACAGCGTGCAG GCCAAGGTGGAGATGCTAGACA

ACCTCCTGGACATCGAGGTGGCCTATAGTCTTCTCAGGGGTGGCTCTGACGACAGCAGCAAGGATCCCATCGACGTCAACTACGAGAAACTCAAAACTGA

CATTAAG GTGGTTGACAGAGATTCTGAAGAGGCCGAGGTCATCAGGAAGTACGTGAAGAACACTCATGCTACCACGCACAACGCCTATGACCTGGAAGT

GATCGAT - UNI8282 - ATCTTCAAGATAGAGCGCGAGGGGGAGAGCCAGCGCTACAAGCCCTTCAGGCAGCTTCACAACCGGAGGCTGCTGTGGCA

CGGCTCCAGGACCACCAACTTTGCTGGCATCCTGTCGCAGGGTCTGCGGATAGCCCCACCTGAAGCGCCTGTG ACAGGCTACATGTTTGGGAAAGGGAT

CTACTTTGCCGACATGGTGTCCAAAAGTGCAAACTACTGCCACACATCTCAGGGAGACCCGATTGGCTTAATACTGCTGGGAGAGGTTGCCCTTGGAAAC

AT GTATGAACTCAAGCATGCTTCACATATCAGCAAGTTACCCAAGGGCAAGCACAGTGTCAAAG GTTTGGGAAAAACCACCCCTGACCCTTCGGCCAG

CATCACCCTGGAGGGTGTAGAGGTTCCACTGGGAACAGGGATCCCATCTGGTGTCAACGACACCTGCCTGCTGTATAATGA GTACATTGTCTACGACAT

TGCTCAGGTGAATCTCAAATACCTGCTGAAACTCAAGTTCAATTTTAAGACATCCCTGTGGTAAAGTGCGAGGGGTGGGCTGTGCCCAGCACCCAGGGCC

TAGGGGGCAATTCTCCCTAGTGCCTCTGCACCAGACACCACAAAACCTCAGCCATGCTGCCGCCGAAGGGTGGCCCCCTCACCGAATCTCCTTAGGAAGG

GTTTTATACAGACAGGTTAAAGGGCTCTGGTTTCAAGTCCCTTGTCCATGCTGCACTGGGGCAGGCCGGTTGTTTGTGGTTTGTCCTACCAGCCACAGCT

CCATAGACAGCAGCTGGCAGTAGAGCAAAAGTTGGGGAGAGGATTTTGTTGTTTGCCTAGACTAGTCCTGAGGGAAGAAACACCACGTCACAGTCACGAT

GTCTGCCTTACTGGCTTCCCCAGGGAAGGAAAAATGTGCTTCCTCCCTTTTTTCAAGGGTTCATCTTTGCTTTAATTTTGGCAAAATGTTAAGCATTTAT

TTTGAGCTAAAAATAAAAGTTAATTTCATACT
Translation
MAEASERLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQ - UNI7195 - SPMFDGKVPHWYHFSCFWKVGHSIRQPDVEVDGFSELRWDDQQKVKK

TAEAGGVAG GKGQDGSGGKAEKTLGDFLAEYAKSNRSMCKGCLEKIEK GQMRLSKKMVDPEKPQLGMIDRWYHPTCFVKKRDELGFRPEYSASQLKGF

SLLSAEDKEALKKQLPAIKNEG GKRKGDEVDGTDEVAKKKSKKGKDKDSSKLEKALK AQNELIWNIKDELKKACSTNDLKELLIFNQQQVPSGESA I

LDRVADGMAFGALLPCKECSGQLVFKSDAYYCTGDVTAWTKCMVKTQNPSRKEWVTPK - UNI7338 - EFREISYLKKLKVKKQDRIFPPESSAPAP

LALPLSVTSAPTAVNSSAPAD - UNI15242 - DKPLSNMKILTLGKLSQNKDEAKAVIEKLGGKLTGSANKASLCISTKK - UNI15749 - KEV

EKMSKKMEEVKAANVRVVCEDFLQDVSASTKSLQELLSAHSLSSWGAEVKAEPGEVVAPKGKSAAPSKKSKGAVKEEG GVNKSEKRMKLTLKGGAAVDP

DSG - UNI15329 - GLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKESR RYWIFRSWGRVGTVIGSNKLEQMPSKEDAVEHFMKLY

EEKTGNAWHSKNFTKYPKKFYPLEIDYGQ DEEAVKKLTVKPGTKSKLPKPVQELVGMIFDVESMKKALVEYE - UNI4753 - IDLQKMPLGKLSRR

QIQAAYSILSEVQQ AVSQGSSESQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQ AKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIK

 VVDRDSEEAEVIRKYVKNTHATTHNAYDLEVID - UNI8282 - IFKIEREGESQRYKPFRQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPV T

GYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEVALGNM MYELKHASHISKLPKGKHSVKG GLGKTTPDPSASITLEGVEVPLGTGIPSGVNDTC

LLYNE EYIVYDIAQVNLKYLLKLKFNFKTSLW

For any suggestions or comments, please send an email to unitrap@crg.es