Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026499 (Acbd3)
Chromosomal location
Chr 1: 182656174 - 182684296 (+)
Description
acyl-Coenzyme A binding domain containing 3 Gene [Source:MGI Symbol;Acc:MGI:2181074]
RefSeq_dna
NM_133225 
RefSeq_peptide
NP_573488.1 
UniGene
Mm.472382 
MGI
MGI:2181074 
Uniprot/SWISSPROT
Q8BMP6 
Uniprot/SPTREMBL
Q3TJW1 Q6P9T6 
Human Ortholog
ENSG00000182827 (ACBD3)
Omim not available
UniTrap UNI21580
Vector Insertion
Chr 1: 182656510 - 182663296
Public Clones not available
Private Clones OST325376 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2134
Vector Insertion
Chr 1: 182666982 - 182668593
Public Clones AD0070 (sanger) XC653 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5354
Vector Insertion
Chr 1: 182675389 - 182676924
Public Clones YTA385 (baygenomics)
Private Clones OST55739 (lexicon)
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6473
Vector Insertion
Chr 1: 182677210 - 182682289
Public Clones XE462 (baygenomics) CSA171 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027780
Sequence
AGCAGGAAGTCGATACGTGGCCGCCGCCTGTCCCCGCCGAGGAGGCGCTGCGAGCGGAGATGGCGGCGCAGCTGAACGTAGAGCAGCTCGAGGTGTCGCT

CGACGGTCTCACGCTGAGCCCGGACTCGGAGGAGAGGCCCGGCGCGGAGGGGGCCCCGCCGCAGACGCCGCCGTCCTCGGCCCCGGGGAATGGACTGGGC

TCCGGCGCCTCGGGGCAGCAGCGGGAGCCCGGGGAGGCGGCGGCTGAGGGCGCGGCCGAGGAGGCGCGGCGGATGGAGCAGCACTGGGGCTTTGGCCTGG

AGGAGCTTTACGGCCTGGCGCTGCGCTTCTACAAAA - UNI21580 - TAAAAGATGGCAAAGCCTTTCATCCAACTTATGAAGAAAAACTGAAGTTC

GTGGCACTGCATAAGCAAGTTCTTTTGGGCCCATATAACCCAGACACGTCCCCTGAGGTTGGATTCTTTGATGTGTTGGGGAATGATAGGAG GAGAGAA

TGGGCAGCTCTGGGAAACATGTCCAAGGAGGATGCCATGGTAGAGTTTGTGAAGCTTCTAAATAAGTGTTGTCCTCTCCTCTCGGCATATGTTGCGTCCC

ACAGAATAGAGAAGGAAGAAGAAGAGAAAAGAAG AAAGGCGGAGGAGGAGCGAAGGCAGCGTGAAGAGGAAGAACGAGAGCGGCTGCAAAAGGAAGAAG

AGAAGCGGAAGCGAGAGGAGGAAGACCGGCTGAGACGGGAGGAGGAAGAGAGGCGGCGGATAGAGGAAGAGAGGCTTCGGCTGGAACAGCAAAA - UNI

2134 - GCAGCAGATAATGGCAGCTTTAAACTCGCAGACTGCCGTGCAATTCCAGCAGTATGCAGCCCAGCAGTATCCAGGGAACTACGAACAACAGCA

GATTCTCATCCGCCAGCTGCAGGAGCAGCACTATCAGCAGTATATGCAGCAGTTATATCAAGTCCAGCTTGCACAACAACAG GCAGCATTACAGAAACA

GCAAGAAGTAGTGATGGCTGGGGCATCATTGCCTGCATCATCAAAGGTGAACACAGCTGGAGCAAGTGATACACTGTCAGTTAATGGACAGGCCAAAACC

CACACTGAAAATTCCGAAAAAGTCCTTGAGCCAGAAGCTGCAGAAGAAGCCTTGGAAAATGGACCAAAAG - UNI5354 - ACTCTCTTCCAGTGATT

GCAGCTCCATCCATGTGGACAAGACCACAAATCAAAGACTTTAAAGAGAAGATTCGGCAGGATGCAGATTCTGTGATTACAGTACGTCGAGGAGAAGTCG

TCACCGTCCGAGTCCCGACTCATGAGGAAGGATCATACCTATTTTGGGAATTTGCCACAGACAGTTATGACATTGGGTTTGGGGTTTATTTTGAATGGAC

AGACTCTCCAAATGCTGCTGTCAGTGTGCATGTCAGTGAGTCCAGTGACGAGGAGGAGGAGGAGGAAG - UNI6473 - AAAATGTCACTTGTGAAGA

AAAAGCAAAAAAGAACGCCAACAAGCCTCTGCTGGATGAGATTGTACCTGTGTACCGGCGGGACTGTCACGAGGAAGTATATGCAGGCAGCCACCAGTAT

CCAGGGAGGGGAGTCTATCTCCTCAAGTTTGATAATTCCTACTCTCTGTGGAGGTCCAAGTCCGTCTACTACAGAGTCTATTATACTAGATAGAGCTGCT

GTTCCAGGGTCGGGAGTCTAGGGTTGAGCACAACATGACGTTTAATTTCCTTTGACTTTTGTGGCGCATAGGAGTCCGTGTTTATCTTCTCGATTTTGTT

CTGAGGGTTTATGAACTCATTGAGAACCAGGATTCCTTGAGACTCTTTAGCATTAGTGCTCTGAGGTTAAAAGCAGTTCGGAAGACTCATCTAGCCCTTG

GGTGCTGACCAGCAGAGCTGCTAGTGGATATTGGAGTTACATGAGCTACGTGTTAATATTCAGTCTCCAGAATAAACGTCCCAGCGTTGCCCTGACCTGG

CTGGAGGGCGCATTGCTGTCTGTGCCTGTGTTGTGCACAGCCACAGTTAGTAACTGGGGAAGCTTCTGTACTAGTCTCCTTCAACGCAGCTGGCTTTGAC

TGAGTGCTTTGACAGTTTGAGACTTCACCAAGTATAGTAGAAAAACAAATGGCCTCAACTTGATCTTACCTGAGTAACCAAGGCTGCTTTTGCTTTGGGT

ACAGCTATTTAGTTAGTTGTGTTACAAAGAATTATTTTCTGAGAGAATCTTAAACTTAGAATATTCAGATGCAGTAGATACTGGCGTGTGGAGATTCACA

GACGACCTCAGCACCCATCCCACCAGGTCCCTGGACTCACGGCCTTTCCTTCATTTGCCATTCACATTGCTGCTCACAAAACAGAACTCGGTGACTTTGT

TTTGATATAGTTTTGTGGACCATCTCAAATTAAAACTATTTTCTGTAAAAAATCTATAGCCAGGAGTTTTATAAACTCACCTGGCACCTACTGAGCTAAA

ATATGCAAAATCTGAACTAAAATATGCAAAATCACTTTAATATAATTTGACATTTGAGGAGTACCATTGCACTAACAGGAAATCACTGCCGGAGACAGCC

CACATTTCCTTGTAGTTGTTATTAGGGCACAAACCACTCCACAGTCCCAGTGTGGAGTCACAGTCTAGAGAGAATTGGAAATGCACGTGCTTAAATGATA

CAGCTTTAATCTGTATTATGACTGCTGGTGGTAAGAGGAATATCTTTAAATTTCTTATGAAAACAAATCCACATTCATTATTTCACATTTGTCTAAGAGG

TTAAGTATCTGAAGGGAGGGTAGTGTAGATAGCAAATGACAGAGACAGTACACACCTAGTGTATTGTCACTGAAGTCTTAGGTTTAACTTTGACATCACA

GGTCCCTTCCAGGGGTACCACTGGGTAGCTGCAGTGTGCACCGGTCACTACATTCAGGCTATTTGAGGTTTTCATATGCTGCATTTCTTTGTTTTTAACA

CCTGGTTTTATAGGTTCTCTTTCGTTTGTTAAGAAACTGGATTCTTTTCTCCTAACCAGTGCTTAATTTGTGTTTTTGGATTTTCTTTCAGAAGTAGTCA

AATGTCTATGCTGTTACATCCAGAATATTCATTAGGCTGCCCCACAGCTCTTCTGTATATATAGAGACCACAGAGTTAGGATTTTTTTTAATGAGAAAAA

TACTGTATTTAAAATGTAAAATAAACTTTTAAAAAGCAAGCACTAATATATATTTCTTTCAGCCTTTGATTACAGTTTTGTCCTTGCACATGTTAAGATA

AATTATCTTCTAAAACCTTGTTCTTGGGAGCAGTGAATGTCACTTTACATGGCTGTTTCTGTCACATGTTCATATCTGAACATTTTTGGTTATAACTTTT

TTATTGCCTTTGGCTGTTGATTAGTACAAGTGCAATTTCAAAAAGATCTTGAAAGTAATATATTTAATCAATTAAAATGTTTCTCTGT
Translation
MAAQLNVEQLEVSLDGLTLSPDSEERPGAEGAPPQTPPSSAPGNGLGSGASGQQREPGEAAAEGAAEEARRMEQHWGFGLEELYGLALRFYKI - UNI2

1580 - IKDGKAFHPTYEEKLKFVALHKQVLLGPYNPDTSPEVGFFDVLGNDRR RREWAALGNMSKEDAMVEFVKLLNKCCPLLSAYVASHRIEKEEE

EKRR RKAEEERRQREEEERERLQKEEEKRKREEEDRLRREEEERRRIEEERLRLEQQK - UNI2134 - KQQIMAALNSQTAVQFQQYAAQQYPGNY

EQQQILIRQLQEQHYQQYMQQLYQVQLAQQQ AALQKQQEVVMAGASLPASSKVNTAGASDTLSVNGQAKTHTENSEKVLEPEAAEEALENGPKD - UN

I5354 - DSLPVIAAPSMWTRPQIKDFKEKIRQDADSVITVRRGEVVTVRVPTHEEGSYLFWEFATDSYDIGFGVYFEWTDSPNAAVSVHVSESSDEEE

EEEE - UNI6473 - ENVTCEEKAKKNANKPLLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR

For any suggestions or comments, please send an email to unitrap@crg.es