Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026519 (Tmem63a)
Chromosomal location
Chr 1: 182872597 - 182905234 (+)
Description
transmembrane protein 63a Gene [Source:MGI Symbol;Acc:MGI:2384789]
RefSeq_dna
NM_144794 
RefSeq_peptide
NP_659043.1 
UniGene
Mm.185518 Mm.416033 
MGI
MGI:2384789 
Uniprot/SWISSPROT
Q91YT8 
Human Ortholog
ENSG00000196187 (TMEM63A)
Omim not available
UniTrap UNI19212
Vector Insertion
Chr 1: 182872691 - 182876696
Public Clones IST14698A3 (tigm)
Private Clones OST401321 (lexicon) OST308019 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34464
Vector Insertion
Chr 1: 182899039 - 182900310
Public Clones IST12808H8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027800
Sequence
ACTTTGTAACTTTTAAGTGGTGCGGACGCCACCCCGCCTCGCCAGGTACGGACTGACCACTCCCCCGGGCGCGCGCGCCGCGCCGCCGCCGCAG - UNI

19212 - GGAGAGAAGGCACAATGACCAGCTCCCCGTTCCTGGATCCCTGGCCGTCCAAGGCTGTGTTTGTCCGTGAGCGCCTGGGTCTTGGCGAACGT

CCCAATGACTCCTATTGCTACAACTCAGCCAAAAACAGCACTGTGCTCCAAGGGGTCACCTTTGGAGGCATCCCCACTGTCCTGCTCTTAGATGTCAGTT

GCTTTCTG TTTCTAATCCTGGTGTTTTCCATCATAAGGAGAAGATTCTGGGATTATGGCCGCATAGCCCTGGTATCAGAAGCAGGCAG TGAGGCCAGG

TTCCAGAGACTGTCCTCTTCCTCCTCAGGGCAACAAGACTTTGAAAACGAGCTG GGATGCTGTCCTTGGCTGACGGCCATCTTCCGCCTGCA TGACGA

CCAGATCCTGGAGTGGTGCGGAGAGGACGCCATCCACTACCTGTCTTTTCAGAGGCACATCATCTTCCTGCTGGTGGTGATCAGCTTCTTGTCCCTGTGT

GTCATCTTGCCTGTCAACCTCTCGGGAGACTTGCTGG GTAAAGACCCTTACAGCTTTGGGAGGACAACGATAGCTAACCTGCAGACTGA CAATGACCT

CCTCTGGCTGCACACTGTCTTCAGCGTCATCTACCTCTTCCTCACGGTGGGCTTCATGTGGCATCACACACGGTCCATCAGATACAAAGAGGAGAGTCTG

 GTGAGACAAACCTTGTTCATCACAGGACTCCCCAGAGAAGCCAGAAAGGAGACTGTGGAGAGCCACTTCCG AGATGCGTATCCCACGTGTGAGGTGGT

GGATGTCCAGCTGTGCTACAGCGTGGCTAAGCTGATCTACCTGTGCAAAGAGAG AAAGAAGACCGAGAAGAGCCTTACCTATTACACAAACCTGCAGGC

GAAGACAGGCCGACGGACCCTCATCAACCCCAAGCCTTGTGGCCAGTTCTGCTGCTGTGAAGTTCAGGGTTGTGAGCGG GAAGATGCTATTTCTTACTA

CACTCGAATGAATGACAGCCTGCTGGAGAGGATCACAGCCGAAGAGAGCCGGGTCCAGGACCAGCCCCTGGGAATGGCCTTTGTCACCTTCCGTGAGAAG

TCCATGGCTACCTA CATACTGAAAGACTTCAATGCCTGCAAGTGCCAGGGCCTTCGGTGCAAAGGGGAGCCCCAGCCATCCTCCTATAGCAGAGAGCTC

TGTGTCTCCAAGTGGACGGTCACTTTTGCCTCCTATCCTGAGGACATCTGCTG GAAGAACCTCTCCATCCAGGGCGTTCGCTGGTGGCTCCAGTGGCTG

GGTATCAACTTCTCTCTGTTTGTGGTGCTGTTTTTCCTGACCACGCCCTCCATCATTATGTCTACCATGGACAAGTTCAATGTTACCAAACCCATCCACG

CACTGAAT AACCCCGTCATCAGCCAGTTCTTCCCCACACTCCTGCTGTGGTCCTTCTCTGCGCTGCTTCCGTCCATTGTCTACTACTCCACGCTGCTGG

AGTCCCACTGGACAAG GTCAGGGGAAAACCGGATCATGGTGTCGAAGGTCTACATATTTTTGATCTTCATGGTGCTGATCCTGCCCTCCCTCGGTCTCA

CCAG CTTGGATTTCTTCTTCCGGTGGCTCTTTGACAAAACTTCCTCGGAAACCTCAATCAGGCTAGA GTGTGTCTTCCTGCCAGACCAGGGTGCCTTC

TTTGTGAACTACGTCATCGCCTCAGCCTTCATCGGCAGTGGCATGGAGCTGTTGCGCCTGCCCGGCCTCATCCTCTATACCTTCCGCATGATCATGGCCA

AGACGGCCGCTGACCGCAGGAATGTTAAGCAG - UNI34464 - AACCAGGCTTTTGAATACGAGTTTGGAGCCATGTATGCGTGGATGCTGTGTGTC

TTCACCGTCATCATGGCTTACAGCATCACCTGCCCCATTATCGTGCCCTTTG GCCTCATCTACATCCTGCTTAAGCACATGGTGGACCGGCATAACCTC

TACTTCGCTTACCTCCCGGCTAAACTGGAGAAGAGGATCCACTTCGCCGCCGTGAACCAGGCCCTGGCCGCCCCCATCCTCTGCCTCTTCTGGCTCTTCT

TTTTCTCCTTCCTCCGTCTGG GTCTGACGGCCCCGGCCACGCTCTTCACCTTCCTGGTTGTTCTGCTCACCATCCTGGCCTGCCTGCTGTACACCTGCT

TTGGATGCTTCAAGCACCTCAGCCCATGGAACTACAAG ACAGAAGAATCAGCTAGTGACAAAGGAAGCGAAGCCGAGGCCCACGTGCCCCCGCCATTCA

CA CCCTATGTGCCTCGGATTCTGAACGGTTTGGCCTCAGAGAGGACAGCGTTATCCCCACAGCAGCAGCAGACCTACGGTGCCATCCGTAACATCAGTG

GGACTCTTCCTGGGCAGCCCGTGGCTCAAGATCCTAGTGGCACTGCGGCTTATGCCTACCAGGAATCCTGAGAGTGGACAAGCTGGTCTGGCAGGCTGGG

AGCATCTAGGAATACCGAGGGACACAAGGGGCTAGAGCCCCAGACAGGCTCTTGAGGGTTTTGCTGCTTAAAACCCCCGTATTGTGAGAAGAGGAAACCA

GCGGGTCGTGGGGCTCTGGGTAACCGGGCTGAGGGTATCCATCCGGTGGGGCTGCTGTCCCTGGGAGCCATCTGTAAGGTTTCTTTTCTGGTCCCAGTGT

GGGGAACATTTACAGCTCCCTCTTGTGGTCATCTGAGGATATGCACTTTTATTCCCCCATACACTGCTCAGGATGCTCTCTGTAGTGAGCATGGTGTATG

TCCCTAGTGGTTTGTGGCCAAGATCATGTGTTGGGCTTTTGCCTTTAGGGAGATCATATTTGGGGACTTCTGGTTGATGGGGAGATGCGTCCAGGAAAGA

CTTAGTCCCTCTGAGCCCTGGAACACTGCTTAGCCTTCTGCAAGCTGATGAATAGCGCATCAGTTGGGTCTGAGATGGAGGCCATGTGGGGCCCTACAGT

ACTGTCCTGCCTGCAGTCCCTTTTCAGGGATCCATGGATTAGCTGTAGGGACCGGGGAATACCTTGTTCTTGTTGATGGCAGCAGGGCAGCAGGCTCATG

CCCACTGGTTTGTAGCTGCCTCCTGCTGTGTTTCCGGGTTTTTGTATCATGTTGCCTGAATCTGGGCTGTGACTGGGTAACCCCACAGCAGGTGGGGACA

TGAGAACCATTAATAAAGTACCCACTGGGCTGGTGGTG
Translation
 - UNI19212 - MTSSPFLDPWPSKAVFVRERLGLGERPNDSYCYNSAKNSTVLQGVTFGGIPTVLLLDVSCFL FLILVFSIIRRRFWDYGRIALVS

EAGS SEARFQRLSSSSSGQQDFENEL GCCPWLTAIFRLH HDDQILEWCGEDAIHYLSFQRHIIFLLVVISFLSLCVILPVNLSGDLLG GKDPYSFG

RTTIANLQTD DNDLLWLHTVFSVIYLFLTVGFMWHHTRSIRYKEESL VRQTLFITGLPREARKETVESHFR RDAYPTCEVVDVQLCYSVAKLIYLCK

ER RKKTEKSLTYYTNLQAKTGRRTLINPKPCGQFCCCEVQGCER EDAISYYTRMNDSLLERITAEESRVQDQPLGMAFVTFREKSMATY YILKDFNA

CKCQGLRCKGEPQPSSYSRELCVSKWTVTFASYPEDICW WKNLSIQGVRWWLQWLGINFSLFVVLFFLTTPSIIMSTMDKFNVTKPIHALN NPVISQF

FPTLLLWSFSALLPSIVYYSTLLESHWTR RSGENRIMVSKVYIFLIFMVLILPSLGLTS SLDFFFRWLFDKTSSETSIRLE ECVFLPDQGAFFVNYV

IASAFIGSGMELLRLPGLILYTFRMIMAKTAADRRNVKQ - UNI34464 - NQAFEYEFGAMYAWMLCVFTVIMAYSITCPIIVPFG GLIYILLKHM

VDRHNLYFAYLPAKLEKRIHFAAVNQALAAPILCLFWLFFFSFLRLG GLTAPATLFTFLVVLLTILACLLYTCFGCFKHLSPWNYK TEESASDKGSEA

EAHVPPPFT PYVPRILNGLASERTALSPQQQQTYGAIRNISGTLPGQPVAQDPSGTAAYAYQES

For any suggestions or comments, please send an email to unitrap@crg.es