Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026527 (Rgs7)
Chromosomal location
Chr 1: 176989348 - 177421261 (-)
Description
regulator of G protein signaling 7 Gene [Source:MGI Symbol;Acc:MGI:1346089]
RefSeq_dna
NM_011880 
RefSeq_peptide
NP_036010.2 
MGI
MGI:1346089 
Uniprot/SWISSPROT
O54829 
Uniprot/SPTREMBL
Q45FE4 Q80XD3 Q45FE2 Q45FE1 Q45FE5 
Human Ortholog
ENSG00000182901 (RGS7)
Omim not available
UniTrap UNI29815
Vector Insertion
Chr 1: 177200947 - 177421262
Public Clones E058H08 (ggtc) IST14626D5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35803
Vector Insertion
Chr 1: 177083254 - 177119359
Public Clones IST14054E6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31447
Vector Insertion
Chr 1: 177023934 - 177051941
Public Clones IST11108A2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027812
Sequence
ATGGCTCAGGGAAATAATTATGGACAGACCAGCAACGGGGTGGCGGACGAATCACCCAACATGCTGGTGTACAGAAAG - UNI29815 - ATGGAAGA

TGTCATAGCACGTATGCAAGACGAGAAAAACGGAATTCCCATCCGTACCGTCAAAAGCTTCCTTTCCAAGATCCCCAGTGTGTTCTCCG - UNI29815

 - - UNI35803 - GGTCAGACATTGTTCAATGGTTAATAAAGAACTTAACTATAGAAGATCCAG - UNI35803 - TGGAGGCTCTCCATTTGGG

AACGCTAATGGCTGCCCATGGCTACTTCTTTCCCATCTCAGATCATGTCCTCACACTCAAGGATGACGGCACCTTCTACCGGTTTCAA - UNI35803 

- ACACCCTATTTTTGGCCGTCAAATTGTTGGGAGCCAGAAAACACAGACTATG CTGTTTACCTCTGCAAGAGAACAATGCAAAACAAGGCAAGGCTAG

AGCTAGCAGATTATGAAGCC GAGAGCCTGGCCAGGCTGCAGAGAGCATTTGCCCGGAAGTGGGAGTTCATTTTTATGCAAGCAGAAGCACAAGCTAA -

 UNI31447 - AGTGGACAAGAAGAGAGACAAAATTGAAAGGAAGATCCTCGATAGTCAAGAGAGAGCATTCTGGGATGTCCACAGGCCTGTG - UNI

31447 - CCTGGATGTGTAAATACTACAGAAGTGGACATTAAGAAGTCATCCCGGATGAGAAACCCACACAAAACACGAAAG - UNI31447 - TCT

GTCTATGGTTTACAAAATGACATCCGAAGTCACAGTCCCACCCACACACCTACACCAGAAACCAAGCCTCCTACAGAAGATGAGCTGCACCAACAG ATA

AAATACTGGCAAATACAGTTAGATAGACATCGGTTAAAAATGTCAAAAGTTGCTGATAG TCTACTAAGCTATACGGAACAGTATGTAGAATATGACCCG

TTTCTTGTGCCGCCTGACCCTTCCAATCCATGGCTCTCAGATGATACGACTTTCTGGGAACTTGAAGCAAG CAAAGAACCAAGTCAACAGAGGGTAAAA

CGATGGGGTTTTGGTATGGATGAGGCATTGAAAGACCCAGTTGGGCGAGAGCAGTTCCTTAAGTTTCTAGAATCAGAATTCAGCTCAGAGAACTTAAG G

TTCTGGTTGGCAGTGGAGGACCTGAAGAGAAGGCCTATCCGAGAGGTCCCCTCGAGAGTGCAGGAAATATGGCAAGAATTTCTGGCTCCTGGGGCCCCCA

GTGCCATTAACTTGGATTCTAAGAGTTATGACAAGACCACACAGAATGTGAAGGAACCAGGACGATACACATTTGAAGATGCTCAG GAGCATATTTACA

AGCTGATGAAGAGCGACTCATACCCCCGCTTTATAAGATCTAGTGCCTACCAGGAACTTCTACAGGCAAAGAGAAAG GGAAAAACTCTCACATCCAAGA

GGTTAACAAGCCTTGTTCAGTCTTACTAG
Translation
MAQGNNYGQTSNGVADESPNMLVYRK - UNI29815 - MEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSG - UNI29815 - - UNI35803 - 

GSDIVQWLIKNLTIEDPV - UNI35803 - VEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQ - UNI35803 - TPYFWPSNCWEPENTDYA

 AVYLCKRTMQNKARLELADYEA ESLARLQRAFARKWEFIFMQAEAQAK - UNI31447 - KVDKKRDKIERKILDSQERAFWDVHRPV - UNI31

447 - PGCVNTTEVDIKKSSRMRNPHKTRK - UNI31447 - SVYGLQNDIRSHSPTHTPTPETKPPTEDELHQQ IKYWQIQLDRHRLKMSKVADS

 SLLSYTEQYVEYDPFLVPPDPSNPWLSDDTTFWELEAS SKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLR RFWLAVEDLKRRPIRE

VPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFEDAQ EHIYKLMKSDSYPRFIRSSAYQELLQAKRK GKTLTSKRLTSLVQSY
Transcript ENSMUST00000111184
Sequence
AGATGGAAGATGTCATAGCACGTATGCAAGACGAGAAAAACGGAATTCCCATCCGTACCGTCAAAAGCTTCCTTTCCAAGATCCCCAGTGTGTTCTCCG 

- UNI29815 - - UNI35803 - GGTCAGACATTGTTCAATGGTTAATAAAGAACTTAACTATAGAAGATCCAG - UNI35803 - TGGAGGCTC

TCCATTTGGGAACGCTAATGGCTGCCCATGGCTACTTCTTTCCCATCTCAGATCATGTCCTCACACTCAAGGATGACGGCACCTTCTACCGGTTTCAA -

 UNI35803 - ACACCCTATTTTTGGCCGTCAAATTGTTGGGAGCCAGAAAACACAGACTATG CTGTTTACCTCTGCAAGAGAACAATGCAAAACAAG

GCAAGGCTAGAGCTAGCAGATTATGAAGCC GAGAGCCTGGCCAGGCTGCAGAGAGCATTTGCCCGGAAGTGGGAGTTCATTTTTATGCAAGCAGAAGCA

CAAGCTAA - UNI31447 - AGTGGACAAGAAGAGAGACAAAATTGAAAGGAAGATCCTCGATAGTCAAGAGAGAGCATTCTGGGATGTCCACAGGCC

TGTG - UNI31447 - CCTGGATGTGTAAATACTACAGAAGTGGACATTAAGAAGTCATCCCGGATGAGAAACCCACACAAAACACGAAAG - UNI3

1447 - TCTGTCTATGGTTTACAAAATGACATCCGAAGTCACAGTCCCACCCACACACCTACACCAGAAACCAAGCCTCCTACAGAAGATGAGCTGCAC

CAACAG ATAAAATACTGGCAAATACAGTTAGATAGACATCGGTTAAAAATGTCAAAAGTTGCTGATAG TCTACTAAGCTATACGGAACAGTATGTAGA

ATATGACCCGTTTCTTGTGCCGCCTGACCCTTCCAATCCATGGCTCTCAGATGATACGACTTTCTGGGAACTTGAAGCAAG CAAAGAACCAAGTCAACA

GAGGGTAAAACGATGGGGTTTTGGTATGGATGAGGCATTGAAAGACCCAGTTGGGCGAGAGCAGTTCCTTAAGTTTCTAGAATCAGAATTCAGCTCAGAG

AACTTAAG GTTCTGGTTGGCAGTGGAGGACCTGAAGAGAAGGCCTATCCGAGAGGTCCCCTCGAGAGTGCAGGAAATATGGCAAGAATTTCTGGCTCCT

GGGGCCCCCAGTGCCATTAACTTGGATTCTAAGAGTTATGACAAGACCACACAGAATGTGAAGGAACCAGGACGATACACATTTGAAGATGCTCAG GAG

CATATTTACAAGCTGATGAAGAGCGACTCATACCCCCGCTTTATAAGATCTAGTGCCTACCAGGAACTTCTACAGGCAAAGAGAAAG GGAAAAACTCTC

ACATCCAAGAGGTTAACAAGCCTTGTTCAGTCTTACTAGAAGGACCGTCTTTGTCACATGAGTGCTGAACGGAGCCATCGCCCATACCTTGTAGCCCATC

GCTGTTACCTGGAGCCAAGGACGTTAGACCAAGATGTTGCATGAACGAAGGACTGGAATTGTTCTTTTCTGTGTGCACATAAAGGCATCACACTTGCCAA

GGGACGCTGTCATTTCATTGCCTTCATCTTCATGTGTCGTCTGCTTCCCTCTCTCCTCGTGCTAAGCTGGATCCGTGTCCTTTTCTTTTTAACGAGTTCA

AGTGAACGAAAACTTATTTTTCCCCCTTTCCTCTCCTTTTCTTGAAGCTTCTGCTAGATGCACAGTTCACTGAAAATTCAGTCAGTCACAAACTGGAAGA

ATTGTAAAAGAAAAAAAAAGTATATATCACTAAGTACACACATGGCTTCACACTTATTAACTAATAAATTGGCACAGAAGGTGTCGTTTCACCCTTGTAT

CCACAGTCTGAAGCAAGCACCCATTTCCATCGGTTCTCCGGACATTGTCTGTTCCTGTTTCTTGCA
Translation
MEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSG - UNI29815 - - UNI35803 - GSDIVQWLIKNLTIEDPV - UNI35803 - VEALHLGT

LMAAHGYFFPISDHVLTLKDDGTFYRFQ - UNI35803 - TPYFWPSNCWEPENTDYA AVYLCKRTMQNKARLELADYEA ESLARLQRAFARKWEF

IFMQAEAQAK - UNI31447 - KVDKKRDKIERKILDSQERAFWDVHRPV - UNI31447 - PGCVNTTEVDIKKSSRMRNPHKTRK - UNI314

47 - SVYGLQNDIRSHSPTHTPTPETKPPTEDELHQQ IKYWQIQLDRHRLKMSKVADS SLLSYTEQYVEYDPFLVPPDPSNPWLSDDTTFWELEAS 

SKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLR RFWLAVEDLKRRPIREVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGR

YTFEDAQ EHIYKLMKSDSYPRFIRSSAYQELLQAKRK GKTLTSKRLTSLVQSY
Transcript ENSMUST00000085853
Sequence
ATGGCTCAGGGAAATAATTATGGACAGACCAGCAACGGGGTGGCGGACGAATCACCCAACATGCTGGTGTACAGAAAG - UNI29815 - ATGGAAGA

TGTCATAGCACGTATGCAAGACGAGAAAAACGGAATTCCCATCCGTACCGTCAAAAGCTTCCTTTCCAAGATCCCCAGTGTGTTCTCCG - UNI29815

 - - UNI35803 - GGTCAGACATTGTTCAATGGTTAATAAAGAACTTAACTATAGAAGATCCAG - UNI35803 - TGGAGGCTCTCCATTTGGG

AACGCTAATGGCTGCCCATGGCTACTTCTTTCCCATCTCAGATCATGTCCTCACACTCAAGGATGACGGCACCTTCTACCGGTTTCAA - UNI35803 

- ACACCCTATTTTTGGCCGTCAAATTGTTGGGAGCCAGAAAACACAGACTATG CTGTTTACCTCTGCAAGAGAACAATGCAAAACAAGGCAAGGCTAG

AGCTAGCAGATTATGAAGCC GAGAGCCTGGCCAGGCTGCAGAGAGCATTTGCCCGGAAGTGGGAGTTCATTTTTATGCAAGCAGAAGCACAAGCTAA -

 UNI31447 - AGTGGACAAGAAGAGAGACAAAATTGAAAGGAAGATCCTCGATAGTCAAGAGAGAGCATTCTGGGATGTCCACAGGCCTGTG - UNI

31447 - CCTGGATGTGTAAATACTACAGAAGTGGACATTAAGAAGTCATCCCGGATGAGAAACCCACACAAAACACGAAAG - UNI31447 - TCT

GTCTATGGTTTACAAAATGACATCCGAAGTCACAGTCCCACCCACACACCTACACCAGAAACCAAGCCTCCTACAGAAGATGAGCTGCACCAACAG ATA

AAATACTGGCAAATACAGTTAGATAGACATCGGTTAAAAATGTCAAAAGTTGCTGATAG TCTACTAAGCTATACGGAACAGTATGTAGAATATGACCCG

TTTCTTGTGCCGCCTGACCCTTCCAATCCATGGCTCTCAGATGATACGACTTTCTGGGAACTTGAAGCAAG CAAAGAACCAAGTCAACAGAGGGTAAAA

CGATGGGGTTTTGGTATGGATGAGGCATTGAAAGACCCAGTTGGGCGAGAGCAGTTCCTTAAGTTTCTAGAATCAGAATTCAGCTCAGAGAACTTAAG G

TTCTGGTTGGCAGTGGAGGACCTGAAGAGAAGGCCTATCCGAGAGGTCCCCTCGAGAGTGCAGGAAATATGGCAAGAATTTCTGGCTCCTGGGGCCCCCA

GTGCCATTAACTTGGATTCTAAGAGTTATGACAAGACCACACAGAATGTGAAGGAACCAGGACGATACACATTTGAAGATGCTCAG GAGCATATTTACA

AGCTGATGAAGAGCGACTCATACCCCCGCTTTATAAGATCTAGTGCCTACCAGGAACTTCTACAGGCAAAGAGAAAG AGATGCCATGAAAGGCTGCTCC

ACGCCGTACTTAGCCCAAGAGCCTTTGTTTAA
Translation
MAQGNNYGQTSNGVADESPNMLVYRK - UNI29815 - MEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSG - UNI29815 - - UNI35803 - 

GSDIVQWLIKNLTIEDPV - UNI35803 - VEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQ - UNI35803 - TPYFWPSNCWEPENTDYA

 AVYLCKRTMQNKARLELADYEA ESLARLQRAFARKWEFIFMQAEAQAK - UNI31447 - KVDKKRDKIERKILDSQERAFWDVHRPV - UNI31

447 - PGCVNTTEVDIKKSSRMRNPHKTRK - UNI31447 - SVYGLQNDIRSHSPTHTPTPETKPPTEDELHQQ IKYWQIQLDRHRLKMSKVADS

 SLLSYTEQYVEYDPFLVPPDPSNPWLSDDTTFWELEAS SKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLR RFWLAVEDLKRRPIRE

VPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFEDAQ EHIYKLMKSDSYPRFIRSSAYQELLQAKRK RCHERLLHAVLSPRAFV
Transcript ENSMUST00000097460
Sequence
GTGCCGCCTGACCCTTCCAATCCATGGCTCTCAGATGATACGACTTTCTGGGAACTTGAAGCAAG CAAAGAACCAAGTCAACAGAGGGTAAAACGATGG

GGTTTTGGTATGGATGAGGCATTGAAAGACCCAGTTGGGCGAGAGCAGTTCCTTAAGTTTCTAGAATCAGAATTCAGCTCAGAGAACTTAAG GTTCTGG

TTGGCAGTGGAGGACCTGAAGAGAAGGCCTATCCGAGAGGTCCCCTCGAGAGTGCAGGAAATATGGCAAGAATTTCTGGCTCCTGGGGCCCCCAGTGCCA

TTAACTTGGATTCTAAGAGTTATGACAAGACCACACAGAATGTGAAGGAACCAGGACGATACACATTTGAAGATGCTCAG GAGCATATTTACAAGCTGA

TGAAGAGCGACTCATACCCCCGCTTTATAAGATCTAGTGCCTACCAGGAACTTCTACAGGCAAAGAGAAAG TCTGGAAACTCAATGGATCGCAGAACGT

CTCTTGAGAAATTTGCACAGAATGTG AGATGCCATGAAAGGCTGCTCCACGCCGTACTTAGCCCAAGAGCCTTTGTTTAAAGCAAGCTCCTGTCCTCAA

ATCGG GGAAAAACTCTCACATCCAAGAGGTTAACAAGCCTTGTTCAGTCTTACTAGAAGGACCG
Translation
VPPDPSNPWLSDDTTFWELEAS SKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLR RFWLAVEDLKRRPIREVPSRVQEIWQEFLAPGA

PSAINLDSKSYDKTTQNVKEPGRYTFEDAQ EHIYKLMKSDSYPRFIRSSAYQELLQAKRK SGNSMDRRTSLEKFAQNV RCHERLLHAVLSPRAFV 
Transcript ENSMUST00000097459
Sequence
GTGGAGGCTCTCCATTTGGGAACGCTAATGGCTGCCCATGGCTACTTCTTTCCCATCTCAGATCATGTCCTCACACTCAAGGATGACGGCACCTTCTACC

GGTTTCAA - UNI35803 - ACACCCTATTTTTGGCCGTCAAATTGTTGGGAGCCAGAAAACACAGACTATG CTGTTTACCTCTGCAAGAGAACAAT

GCAAAACAAGGCAAGGCTAGAGCTAGCAGATTATGAAGCC GAGAGCCTGGCCAGGCTGCAGAGAGCATTTGCCCGGAAGTGGGAGTTCATTTTTATGCA

AGCAGAAGCACAAGCTAA - UNI31447 - AGTGGACAAGAAGAGAGACAAAATTGAAAGGAAGATCCTCGATAGTCAAGAGAGAGCATTCTGGGATG

TCCACAGGCCTGTG - UNI31447 - CCTGGATGTGTAAATACTACAGAAGTGGACATTAAGAAGTCATCCCGGATGAGAAACCCACACAAAACACGA

AAG - UNI31447 - TCTGTCTATGGTTTACAAAATGACATCCGAAGTCACAGTCCCACCCACACACCTACACCAGAAACCAAGCCTCCTACAGAAGA

TGAGCTGCACCAACAG ATAAAATACTGGCAAATACAGTTAGATAGACATCGGTTAAAAATGTCAAAAGTTGCTGATAG TCTACTAAGCTATACGGAAC

AGTATGTAGAATATGACCCGTTTCTTGTGCCGCCTGACCCTTCCAATCCATGGCTCTCAGATGATACGACTTTCTGGGAACTTGAAGCAAG CAAAGAAC

CAAGTCAACAGAGGGTAAAACGATGGGGTTTTGGTATGGATGAGGCATTGAAAGACCCAGTTGGGCGAGAGCAGTTCCTTAAGTTTCTAGAATCAGAATT

CAGCTCAGAGAACTTAAG GTTCTGGTTGGCAGTGGAGGACCTGAAGAGAAGGCCTATCCGAGAGGTCCCCTCGAGAGTGCAGGAAATATGGCAAGAATT

TCTGGCTCCTGGGGCCCCCAGTGCCATTAACTTGGATTCTAAGAGTTATGACAAGACCACACAGAATGTGAAGGAACCAGGACGATACACATTTGAAGAT

GCTCAG GAGCATATTTACAAGCTGATGAAGAGCGACTCATACCCCCGCTTTATAAGATCTAGTGCCTACCAGGAACTTCTACAGGCAAAGAGAAAG TC

TGGAAACTCAATGGATCGCAGAACGTCTCTTGAGAAATTTGCACAGAATGTG GGCAGAAACCTCCCTATTTTCCCATGCCATAAAAACTGTACACCAAC

ACTGAGGGCCAGCACTAACCTGTTATGAAAAGAG GGAAAAACTCTCACATCCAAGAGGTTAACAAGCCTTGTTCAGTCTTACTAGAAGGACCG
Translation
VEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQ - UNI35803 - TPYFWPSNCWEPENTDYA AVYLCKRTMQNKARLELADYEA ESLARLQR

AFARKWEFIFMQAEAQAK - UNI31447 - KVDKKRDKIERKILDSQERAFWDVHRPV - UNI31447 - PGCVNTTEVDIKKSSRMRNPHKTRK 

- UNI31447 - SVYGLQNDIRSHSPTHTPTPETKPPTEDELHQQ IKYWQIQLDRHRLKMSKVADS SLLSYTEQYVEYDPFLVPPDPSNPWLSDDTT

FWELEAS SKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLR RFWLAVEDLKRRPIREVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTT

QNVKEPGRYTFEDAQ EHIYKLMKSDSYPRFIRSSAYQELLQAKRK SGNSMDRRTSLEKFAQNV GRNLPIFPCHKNCTPTLRASTNLL 

For any suggestions or comments, please send an email to unitrap@crg.es