Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026548 (Slamf9)
Chromosomal location
Chr 1: 174405505 - 174408706 (+)
Description
SLAM family member 9 Gene [Source:MGI (curated);Acc:Slamf9-001]
RefSeq_dna
NM_029612 
RefSeq_peptide
NP_083888.3 
UniGene
Mm.150050 
MGI
MGI:1923692 
Uniprot/SWISSPROT
Q9D780 
Uniprot/SPTREMBL
Q18PH4 Q18PH6 
Human Ortholog
ENSG00000162723 (SLAMF9)
Omim not available
UniTrap UNI26366
Vector Insertion
Chr 1: 174405671 - 174406263
Public Clones not available
Private Clones OST123070 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027830
Sequence
TTTCCCTCTCTGCTTCCTGCCAGTATCAACCAGTCATTCTGCCTCTATGGACCCCTTACCAGCTTGTGTTTCCACAGCCTAGCCAGCTGACCAAGTCACT

CTTCCCAGGCAAGAGCTGCCAATATGGGGGCCCTTCTGTGGTCACTCCTGCTGCTGCTTCAGGAAG - UNI26366 - CCAAAGGGTTTTCTGGAGAT

GATGAGGATCCTGAGGAAGTGGTTGGTGTCCTGCAAGAGTCTATCAACCTCTCTCTGGAAATACCATCCAATGAAGAAATTAAGCACATAGACTGGCTCT

TTCAAAACAACATTGCCATCGTGAAGCCAGGCAAAAAGGGACAGCCAGCCGTTATCATGGCAGTGGATCCTCGATACCGGGGCAGAGTGAGCATCTCTGA

GTCCAGCTACTCCCTGCATATTAGCAATCTGACCTGGGAAGACTCAGGGCTTTACAACGCCCAAGTCAACTTGAAGACATCTGAGTCCCACATCACGAAG

TCTTACCATCTCCGTGTCTACC GGAGGCTGTCAAAGCCCCACATCACTGTGAACTCTAACATCTCAGAGGAAGGTGTCTGTAATATATCTCTGACGTGC

TCCATAGAGAGAGCAGGCATGGACGTGACCTACATCTGGCTTTCATCACAGGACAGCACTAACACATCCCATGAAGGCTCTGTCCTCAGTACATCCTGGA

GGCCTGGTGACAAAGCTCCTTCCTATACTTGCAGGGTCAGCAACCCCATCAGCAACATCAGTTCCCGTCGCATCTCTGTTGGGTCCTTCTGTGCAG ATC

CTGGATATCTGGAGAAGCCTTCAATGCTCTGCTTACTGGTTAAGAGCTTGTTCCTTCTCCTACTCTTGGCAATTCTAACTGTGGGACTCTGCCTCTTCCG

AGCCCAGAAAAGCTATGAGACGCCAAGGGTGAGGAAACTCAAGAGAAACCGCATCAAACTGAGGAAGAAGGGGAAGTCTGGCCCTACTCCCGTCTGATTG

GCTTTTGAGGTCCTCTTCTGAGCTTTGTTTCAGGCTCTAGGGAAATTCTCTGGGGGACTGGTGGGATTGGGATCAGAGTTGAACATCTAAAAGAGCAGTA

TTCCCTGAGAGACACCATCTGAAAATAAAGCCAAGTCCCTACCCCTATGGGGCACCGTGCTTGATGCTTCTGTTTGCGCTGGGCAGTACAGGAAAAATCT

GTTTCCCACCCTTCCTACCTGCCTCAGCATCTTTACTGAAGCCCATGGCCTTCTCGGGCTTGCCTCTGGGTGGGGAAATGAGTCTATTAGAGTGAAATGT

TTGTTTGTGCTGC
Translation
MGALLWSLLLLLQEA - UNI26366 - AKGFSGDDEDPEEVVGVLQESINLSLEIPSNEEIKHIDWLFQNNIAIVKPGKKGQPAVIMAVDPRYRGRVS

ISESSYSLHISNLTWEDSGLYNAQVNLKTSESHITKSYHLRVYR RRLSKPHITVNSNISEEGVCNISLTCSIERAGMDVTYIWLSSQDSTNTSHEGSVL

STSWRPGDKAPSYTCRVSNPISNISSRRISVGSFCAD DPGYLEKPSMLCLLVKSLFLLLLLAILTVGLCLFRAQKSYETPRVRKLKRNRIKLRKKGKSG

PTPV

For any suggestions or comments, please send an email to unitrap@crg.es