Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026554 (Wdr42a)
Chromosomal location
Chr 1: 174078297 - 174125597 (+)
Description
WD repeat domain 42A Gene [Source:MGI Symbol;Acc:MGI:91860]
RefSeq_dna
NM_153555 
RefSeq_peptide
NP_705783.1 
UniGene
Mm.159915 Mm.470423 
MGI
MGI:91860 
Uniprot/SWISSPROT
Q8N7N5 
Human Ortholog
not available
Omim not available
UniTrap UNI22261
Vector Insertion
Chr 1: 174078470 - 174079379
Public Clones (sanger) IST10228E11 (tigm) IST10902C5 (tigm)
Private Clones OST302108 (lexicon) OST183416 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10196
Vector Insertion
Chr 1: 174079453 - 174095978
Public Clones DTM061 (baygenomics) E044F01 (ggtc) D053H05 (ggtc) E041F12 (ggtc)
(ggtc) IST11260F4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17760
Vector Insertion
Chr 1: 174095978 - 174096050
Public Clones not available
Private Clones OST436882 (lexicon) OST358026 (lexicon) OST339357 (lexicon) OST284270 (lexicon)
OST267348 (lexicon) OST266334 (lexicon) OST114372 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10040
Vector Insertion
Chr 1: 174096050 - 174102459
Public Clones XC322 (baygenomics)
Private Clones OST364333 (lexicon) OST224315 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI989
Vector Insertion
Chr 1: 174123915 - 174124033
Public Clones AZ0424 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000074144
Sequence
AGTGTAAGATGGCGGCGGCGTTGGTGGCGGCAGTGGACGGGGCGGCTGGGCCTGGAACAGTCGGAGCATCCGCTGGCAGAAGGATGACCCTAGATGGGAA

GCGGGCTGCCGGGCCTCGCCAGCTCCCGTGCTTGTAACTGCCCCAGCCGGACGCCCTCCCCTTGACCTACCGG - UNI22261 - TTCTTCAGCGAAC

CTCCAGACCAGTTTTCTCAGGATCTTGGGCCTGACTTCGGTCGGCGATAAAAGCAGGAAG - UNI10196 - - UNI17760 - GCTGGCGACCATA

TTTAAGATGTCCAATAAACGTCCCAACACGACAGATGGGAGAACAGATTTAGCTAATG - UNI10040 - - UNI17760 - GAAGTCTGTCCAGCA

GCCCAGAGGAGATGTCTGGAGCTGAAGAGGGGAGGGAAACATCCTCAGGGATTGAAGTAGAGGCATCAGACCTGAGTCTCAGCTTGACTGGGGATGACGG

TGGCCCCAACCGCACCAGCACGGAAAGTCGTGGCACAGACACAGAGAGCTCAGGGGAAGAAAAGGACTCTGACAGCATGGAGGACACGGGCCATTATTCC

ATCAATGATGAAAGCCGAGGTCATGGCCACTCAGACGAAGAGGACGAGGAACAACCTCGGCACCGTGGACAGCGCAAACGGGCCAGCCGTGACCAGGATT

CATCAGATGATGAGCGAGCCCTGGAAGACTGGGTATCTTCAGAGACAACAGCCTTACCCCGACCTCGCTGGCAAGCCCTTCCTGCGCTTCGGGAGCGGGA

ACTGGGTTCCAGTGCCCGCTTTGTGTACGAGGCTTGTGGAGCTAGAGTCTTTGTACAGCGTTTCCGTTTGCAGCACGGGCTTGAGGGCCATACTGGTTGT

GTCAATACCTTGCACTTTAACCAGCGTGGTACCTGGCTGGCCAGTGGCAGTGATGACCTGAAGGTGGTGGTGTGGGATTGGGTGCGGCGGCAGCCAGTAC

TGGACTTTGAGAGTGGCCACAAAAGTAATGTCTTCCAG GCCAAGTTCCTTCCTAACAGTGGTGACTCCACCCTGGCTATGTGTGCCCGGGATGGACAGG

TCCGAGTCGCAGAGCTGTCTGCTACACAGTGCTGCAAGAACACCAAGCGTGTGGCCCAGCACAAGGGGGCATCTCACAAG TTAGCCCTAGAACCAGACT

CCCCCTGCACGTTCCTGTCAGCTGGTGAAGATGCCGTCGTCTTCACCATTGACCTGAGACAAGACCGGCCAGCTTC GAAACTAGTGGTGACAAAAGAGA

AGGAGAAGAAAGTGGGGCTGTATACAATCTATGTGAACCCTGCCAATACCCACCAGTTTGCAGTGGGTGGAAGAGATCAGTATGTAAG GATTTATGACC

AGAGGAAAATTGATGAGAATGAGAACAACGGAGTCCTGAAAAAATTCTGTCCTCACCACTTG GTGAACAGTGAGTCCAAAGCAAACATCACCTGTCTTG

TGTACAGCCACGACGGCACAG AGCTCCTGGCCAGTTACAATGATGAAGACATTTACCTTTTCAACTCTTCTCACAGTGATGGGGCCCAGTATATTAAGA

GATACAAAGGCCATAGAAATAATGCTACAG TAAAAGGCGTCAATTTCTATGGCCCCAAGAGTGAGTTTGTGGTGAGCGGTAGTGACTGCGGGCACATCT

TCCTCTGGGAGAAGTCATCTTGCCAGATTATTCAGTTCATGGAAGGGGACAAGGGAGGTGTG GTAAACTGTCTTGAGCCCCATCCTCATCTGCCTGTTT

TGGCAACCAGTGGCCTAGACCATGATGTGAAGATCTGGGCGCCGACAGCTGAAGCTTCCACTGAGCTGACAGGGTTAAAGGAA - UNI989 - GTGAT

CAAGAAGAACAAGCGAGAGCGGGATGAAGACAGCTTGCACCACACTGATCTGTTTGATAGTCACATGCTGTGGTTCCTTATGCATCACCTGAGACAGAGA

CGCCATCATCGG - UNI989 - CGCTGGCGAGAACCTGGGGTTGGGGCCACAGATGCAGACTCTGATGAGTCTCCCAGCTCCTCAGACACATCCGACG

AGGAGGAGGGCCCTGACCGGGTGCAGTGCATGCCATCCTGAGGCCCCACACCTAGGAGGGATGGGCTGGGGCTGCCAACCCGATCCTGCCTGGGCAACTC

TTTTTCAGTCCCAGGCCCTTACATTCAACAGAAATGCACTTTGGACTTTTTGTTTAAATAAAAGAAAGATACCTGAGGAGGACAGAGCACAGGAGACGGA

ACCAGCAGAGAGCCCCTAGAAGTGAGAGATGAGAAGGAGCCTGAATGAGCTTCCATGGAAGGTGCAAAGGACTCAGAGAAATGGGCCTCTCCCTGAAGCC

TTTTGTCAATGGGCTTGGATAGGAAGTGGGGCTTCTTTTTCTTTAACCTCCCTTGTTTCTTTTGGGGGTGGGGGGTACCAATAGGCCAGAGAGAAGGCTG

GGCATGCCACTCTCTTTGGTTTAGGGTTTCACCTTTTTTTTTTCCTTTGTTTTTTAAGAAGTCTGACAGTTGCTTTGTTTTTTGCCCGAGCAACCACGTC

CCATCCCAGGATCCTGTTTTTCTGGGAAATCCTTAAGAGCCCCCAGCCACCCCAGCACTCTGCTCTCCCTTCCACAACACTTACTCTCTGACCTTACCAC

AGTGCTCTGCACTGCTGCCCGTTGTCTCCTTCACTCACTCGTCATCCAGCGCCCTCTAAATGGGGGCTGGGATGGGGACTGAGGAGACGTGGGAGGGACA

AGAGACGGAAAAACAGGAAGAAGTTACCTCTTGGTTTTGGTTTTAACTGTTCAGTGGTGGCAATTTCCCTGTCCCTATCACTGTTAGAGGCCTACTTTTA

TATCTATAAATATATTAAAAAGCAAGTTAAACTTG
Translation
 - UNI22261 -  - UNI10196 - - UNI17760 - MSNKRPNTTDGRTDLANG - UNI10040 - - UNI17760 - GSLSSSPEEMSGAE

EGRETSSGIEVEASDLSLSLTGDDGGPNRTSTESRGTDTESSGEEKDSDSMEDTGHYSINDESRGHGHSDEEDEEQPRHRGQRKRASRDQDSSDDERALE

DWVSSETTALPRPRWQALPALRERELGSSARFVYEACGARVFVQRFRLQHGLEGHTGCVNTLHFNQRGTWLASGSDDLKVVVWDWVRRQPVLDFESGHKS

NVFQ AKFLPNSGDSTLAMCARDGQVRVAELSATQCCKNTKRVAQHKGASHK LALEPDSPCTFLSAGEDAVVFTIDLRQDRPAS SKLVVTKEKEKKVG

LYTIYVNPANTHQFAVGGRDQYVR RIYDQRKIDENENNGVLKKFCPHHL VNSESKANITCLVYSHDGTE ELLASYNDEDIYLFNSSHSDGAQYIKRY

KGHRNNATV VKGVNFYGPKSEFVVSGSDCGHIFLWEKSSCQIIQFMEGDKGGV VNCLEPHPHLPVLATSGLDHDVKIWAPTAEASTELTGLKE - UN

I989 - VIKKNKRERDEDSLHHTDLFDSHMLWFLMHHLRQRRHHR - UNI989 - RWREPGVGATDADSDESPSSSDTSDEEEGPDRVQCMPS
Transcript ENSMUST00000085918
Sequence
AGTGTAAGATGGCGGCGGCGTTGGTGGCGGCAGTGGACGGGGCGGCTGGGCCTGGAACAGTCGGAGCATCCGCTGGCAGAAGGATGACCCTAGATGGGAA

GCGGGCTGCCGGGCCTCGCCAGCTCCCGTGCTTGTAACTGCCCCAGCCGGACGCCCTCCCCTTGACCTACCGG - UNI22261 - TTCTTCAGCGAAC

CTCCAGACCAGTTTTCTCAGGATCTTGGGCCTGACTTCGGTCGGCGATAAAAGCAGGAAG - UNI10196 - - UNI17760 - GCTGGCGACCATA

TTTAAGATGTCCAATAAACGTCCCAACACGACAGATGGGAGAACAGATTTAGCTAATG - UNI10040 - - UNI17760 - GAAGTCTGTCCAGCA

GCCCAGAGGAGATGTCTGGAGCTGAAGAGGGGAGGGAAACATCCTCAGGGATTGAAGTAGAGGCATCAGACCTGAGTCTCAGCTTGACTGGGGATGACGG

TGGCCCCAACCGCACCAGCACGGAAAGTCGTGGCACAGACACAGAGAGCTCAGGGGAAGAAAAGGACTCTGACAGCATGGAGGACACGGGCCATTATTCC

ATCAATGATGAAAGCCGAGGTCATGGCCACTCAGACGAAGAGGACGAGGAACAACCTCGGCACCGTGGACAGCGCAAACGGGCCAGCCGTGACCAGGATT

CATCAGATGATGAGCGAGCCCTGGAAGACTGGGTATCTTCAGAGACAACAGCCTTACCCCGACCTCGCTGGCAAGCCCTTCCTGCGCTTCGGGAGCGGGA

ACTGGGTTCCAGTGCCCGCTTTGTGTACGAGGCTTGTGGAGCTAGAGTCTTTGTACAGCGTTTCCGTTTGCAGCACGGGCTTGAGGGCCATACTGGTTGT

GTCAATACCTTGCACTTTAACCAGCGTGGTACCTGGCTGGCCAGTGGCAGTGATGACCTGAAGGTGGTGGTGTGGGATTGGGTGCGGCGGCAGCCAGTAC

TGGACTTTGAGAGTGGCCACAAAAGTAATGTCTTCCAG GCCAAGTTCCTTCCTAACAGTGGTGACTCCACCCTGGCTATGTGTGCCCGGGATGGACAGG

TCCGAGTCGCAGAGCTGTCTGCTACACAGTGCTGCAAGAACACCAAGCGTGTGGCCCAGCACAAGGGGGCATCTCACAAG TTAGCCCTAGAACCAGACT

CCCCCTGCACGTTCCTGTCAGCTGGTGAAGATGCCGTCGTCTTCACCATTGACCTGAGACAAGACCGGCCAGCTTC GAAACTAGTGGTGACAAAAGAGA

AGGAGAAGAAAGTGGGGCTGTATACAATCTATGTGAACCCTGCCAATACCCACCAGTTTGCAGTGGGTGGAAGAGATCAGTATGTAAG GATTTATGACC

AGAGGAAAATTGATGAGAATGAGAACAACGGAGTCCTGAAAAAATTCTGTCCTCACCACTTG AGCTCCTGGCCAGTTACAATGATGAAGACATTTACCT

TTTCAACTCTTCTCACAGTGATGGGGCCCAGTATATTAAGAGATACAAAGGCCATAGAAATAATGCTACAG TAAAAGGCGTCAATTTCTATGGCCCCAA

GAGTGAGTTTGTGGTGAGCGGTAGTGACTGCGGGCACATCTTCCTCTGGGAGAAGTCATCTTGCCAGATTATTCAGTTCATGGAAGGGGACAAGGGAGGT

GTG GTAAACTGTCTTGAGCCCCATCCTCATCTGCCTGTTTTGGCAACCAGTGGCCTAGACCATGATGTGAAGATCTGGGCGCCGACAGCTGAAGCTTCC

ACTGAGCTGACAGGGTTAAAGGAA - UNI989 - GTGATCAAGAAGAACAAGCGAGAGCGGGATGAAGACAGCTTGCACCACACTGATCTGTTTGATA

GTCACATGCTGTGGTTCCTTATGCATCACCTGAGACAGAGACGCCATCATCGG - UNI989 - CGCTGGCGAGAACCTGGGGTTGGGGCCACAGATGC

AGACTCTGATGAGTCTCCCAGCTCCTCAGACACATCCGACGAGGAGGAGGGCCCTGACCGGGTGCAGTGCATGCCATCCTGAGGCCCCACACCTAGGAGG

GATGGGCTGGGGCTGCCAACCCGATCCTGCCTGGGCAACTCTTTTTCAGTCCCAGGCCCTTACATTCAACAGAAATGCACTTTGGACTTTTTGTTTAAAT

AAAAGAAAGATACCTGAGGAGGACAGAGCACAGGAGACGGAACCAGCAGAGAGCCCCTAGAAGTGAGAGATGAGAAGGAGCCTGAATGAGCTTCCATGGA

AGGTGCAAAGGACTCAGAGAAATGGGCCTCTCCCTGAAGCCTTTTGTCAATGGGCTTGGATAGGAAGTGGGGCTTCTTTTTCTTTAACCTCCCTTGTTTC

TTTTGGGGGTGGGGGGTACCAATAGGCCAGAGAGAAGGCTGGGCATGCCACTCTCTTTGGTTTAGGGTTTCACCTTTTTTTTTTCCTTTGTTTTTTAAGA

AGTCTGACAGTTGCTTTGTTTTTTGCCCGAGCAACCACGTCCCATCCCAGGATCCTGTTTTTCTGGGAAATCCTTAAGAGCCCCCAGCCACCCCAGCACT

CTGCTCTCCCTTCCACAACACTTACTCTCTGACCTTACCACAGTGCTCTGCACTGCTGCCCGTTGTCTCCTTCACTCACTCGTCATCCAGCGCCCTCTAA

ATGGGGGCTGGGATGGGGACTGAGGAGACGTGGGAGGGACAAGAGACGGAAAAACAGGAAGAAGTTACCTCTTGGTTTTGGTTTTAACTGTTCAGTGGTG

GCAATTTCCCTGTCCCTATCACTGTTAGAGGCCTACTTTTATATCTATAAATATATTAAAAAGCAAGTTAAACTTG
Translation
 - UNI22261 -  - UNI10196 - - UNI17760 -  - UNI10040 - - UNI17760 - MEDTGHYSINDESRGHGHSDEEDEEQPRHRGQ

RKRASRDQDSSDDERALEDWVSSETTALPRPRWQALPALRERELGSSARFVYEACGARVFVQRFRLQHGLEGHTGCVNTLHFNQRGTWLASGSDDLKVVV

WDWVRRQPVLDFESGHKSNVFQ AKFLPNSGDSTLAMCARDGQVRVAELSATQCCKNTKRVAQHKGASHK LALEPDSPCTFLSAGEDAVVFTIDLRQDR

PAS SKLVVTKEKEKKVGLYTIYVNPANTHQFAVGGRDQYVR RIYDQRKIDENENNGVLKKFCPHHL SSWPVTMMKTFTFSTLLTVMGPSILRDTKAI

EIMLQ Q  - UNI989 -  - UNI989 - 

For any suggestions or comments, please send an email to unitrap@crg.es