Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026564 (Dusp27)
Chromosomal location
Chr 1: 168028284 - 168058029 (-)
Description
dual specificity phosphatase 27 (putative) Gene [Source:MGI Symbol;Acc:MGI:2685055]
RefSeq_dna
NM_001033344 
RefSeq_peptide
NP_001028516.1 
UniGene
Mm.35315 
MGI
MGI:2685055 
Uniprot/SWISSPROT
Q148W8 
Human Ortholog
ENSG00000198842 (DUSP27)
Omim not available
UniTrap UNI15615
Vector Insertion
Chr 1: 168057200 - 168058030
Public Clones E098G06 (ggtc) PST4243-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9646
Vector Insertion
Chr 1: 168042257 - 168057200
Public Clones (sanger) XG236 (baygenomics) D073C07 (ggtc) D133B05 (ggtc) E046C03 (ggtc)
E024G10 (ggtc) E122F06 (ggtc) D098A06 (ggtc) E046A06 (ggtc) E023A04 (ggtc)
E115C12 (ggtc) IST14348C12 (tigm) IST12648G10 (tigm) IST12520F8 (tigm)
IST11213H10 (tigm) IST10162A4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000085992
Sequence
AGAGCAGAAGCACACCAGAGAAGAGAAAGCTCCCGTCCCTCTCTAGACCAAACTTCTGGTCACTTTCCTGGGGTTCTTGGTCCTTGGTGAGGACACACCA

GCACAAG - UNI15615 - GCAGACAGAGGCTGACAGGCTGACATGGCTACCGGTGGAGACGCAGAGGAGGAGCAGGTAGTTCCAAACGAGGAGGATG

AAGCAGATGTGAGAGCTGTACAGGCCCGCTATCTCCGGAGTCCCTCCCCAAGCCA - UNI9646 - - UNI15615 - GTACTCGGTGGTCTCAGAG

GCAGAAACCGAAAGCATCTTCATGGAGCCCATCCACCTCTCCTCGGCTGTAGCTGCCAAACAGATCATCAACGAAG AACTCAAGCCTCGGGGGCTCAGA

ACAGACACTGAGTGTCCAGGCATGCTGGAGTCTGCTGAACAACTGCTGGTGGAAGACCTGTACAACCGTGTCCGTGAGAAGATGGATGACAGGAGCCTGT

TCAACACCCCCTGTGTGCTGGACCTGCAGCGGGCGCTGACCCAGGACCGGCAAGAGGCCCCTCGGAATGAGGTGGATGAGGTGTGGCCCAACGTCTTCAT

AGCTGAGAA AAGCGTGGCTGTGAACAAGGGGCGGCTCAAGAGGCTGGGCATCACCCACATTCTGAATGCCGCACATGGCACAGGAGTTTACACTGGTTC

TGAATTCTACACTGGCCTGGAGATCCAGTACCTGGGGGTGGAAGTGGATGACTTCCCAGAGGTGGACATCTCCCAACATTTCCGGAAAGCAGCTGAGTTC

CTTGACGAAGCTCTGCTGACCTACAGAG GGAAAGTCCTGGTCAGCAGTGAAATGGGTATCAGCAGGTCAGCAGTGCTGGTGGTCGCCTACCTGATGATC

TTCCACAGCATGGCCATCCTGGAGGCCTTGATGACTGTGCGCAGAAAGCGAGCTATCTACCCCAATGACGGCTTCCTAAAACAACTGCGGGAGCTCAATG

AGAAATTGATGGAGGAGAGGGAAGAGGAGGATGGTGAAGAGGAGTCTGAGGAAGATGCCGGGAGCATGCTGGGTGCTAGAGTCAATTCACTGATGGTGGA

AGAAGAAGATGATGCCACTAGCCACCTGAGTGGCTCCTCCTTGGGGAAGGCCAGCCAGGTCTCCAAACCAGTCACTCTTATTGATGACGAGGAGGAGGAG

AAGAAGCTGTATGAAGAGTGGAGGAAGGGGCAGGGCTTCCCCAAGGGGGAGGCTGCTCAGGGTAGAAAGGGACGTAGCTGTTCTATGTCCTCAGCACAGG

ATGGAGACGACTGTGAGGATGAGGATGTAGAAAGGATAATCCAGGAGTGGCAGAGCCGAAATGAGAGGTACCAAGCCAAAGGGCGCGAGCAGTGGAACCG

GGAGGAAGAAGAGGAGGAAGAGAACTCCTACTCCAGCAGAAGGCGCAGACACACCCTAAGCGAGAGCAGTGCTTCTGAGAGTGTGAGCAGCCATGACATC

CGGATCCTGAAGCAGCAACTGGAGAGGAGCACCCAAAGCCGCCGCGGAAGATACCGCTCTGACTCGGAGTCCTCGGAGAGCACCTGGGACATGTGGAACG

AGAGGCTGGTGGAGATCGAGAAGGAGGCTGCCCGGAAGTACCGCTCCAAGAGCAAGAGGGAGGAGCTGGATGGCGATTGTTCAGAGGCAGGGGGCAGGGT

CCGAGAGGACGATGAGGAGAGCGTGTTGTCTGAGGCCAGCTCCTTCTACAACTTCTGCAGTAGGAACAAGGACAAGCTCACTCCCCTGGAAAGGTGGAAG

ATTAAGAGAATCCAATTTGGGTTTCACAAGAAAGACTCGGAGGCGGGAGACGGGGGCAGTGAGCATGGTACAGAAGAGGCAGCAGCAGGAGAGAAGAACC

TCTCTGATGTCAACCTGACAGCCTACCAGGCCTGGAAGCTGAAGCACCAGAAAAAGGTGGGGAGTGAGAACAAGGAGGAAGTGGTTGAGATGAGCAAAGG

AGAAGACACGGTCTTGGCTAAGAAGAGACAGCGGAGACTAGAGTTACTGGAGAGGAGCAGGCAGACACTGGAGGAGAGTCAGTCCATGGGAAGCTGGGAG

GCAGACAGCTCAACAGCCAGCAGGAGCATCCCCCTGTCTGCATTCTCGTCCGCGGCCCCTTCTGTCAGTGCGGATGGGGACACTGCGTCAGTACTCAGCA

CCCAGAGCCACCGTTCTCATGCAAGTAACATGCCCGCCACCCCCCTGCCTAACCTGCCGGTGGGGCCTGGAGACACCATTTCCATTGCCAGTATCCAGAA

CTGGATTGCCAATGTCGTCAATGAAACCCTCGCCCAGAAGCAAAACGAAATGCTCTTGTTGTCCCGCCCACCCTCTGTTGCAAGCATGAAGGCAGCTCCA

GCAGCCTGCGGCCTTGGGGGGGATGACCAGCTCTCCGTGCTCAGCACCTCCCTGAGTGGCTGCTTACCACCTCCAAGCCAAGGGAGACCCAGCTCCGACG

TGCAGTCTGTGCTGTCCTCCACCAGCTCGCTGACCTCCAGGGCTGAAGGCAGTGGGAACAAAGTGAGGGGGACCAGCAAGCCCATCTACAGCCTCTTTGC

TGACAACGTGGACCTGAAGGAGCTTGGCCGGAAGGAGAAAGAGATGCAAATGGAGCTGCAGGAGAAGATGTCCGAGTATAAAATGGAGAAGCTGGCCTCT

GATAACAAGCGTAGCTCTCTCTTCAAGAAGAAGAAGGCCAAGGATGACGAGGACATGAGCGTGGGTGACAGAGACGAGGACACAGACAGTGCCATCGGAA

GCTTCCGGTACTCCTCTCGCAGTAATTCCCAGAAGCCGGAGACAGATGCCTCCTCTTCTCTGGCCATCTCTGATCACTATAGAAATGGCCGCAGCATGGG

TAACGAGATGGATAGCAATATTAATACGTGGCTCAGTGGCCTCAGGATGGAAGAAAAATCTCCTCCTCAAAGTGATTGGTCCGGAAGTTCCAGGGGGAGG

TATACCAGGTCTTCTCTGCTCCGGGAAACAGAGTCTAAATCCTGCAGTTACAAGTTCTCCAAATCTAGGTCACAGGAGCAGGACACCTCCTTCCACGAAG

CCAATGGTGACACTGTGCGAAACACCTCACGGTTCTCATCTTCCACCACCAAGGAGGCCAGAGAGATGCACAAGTTCTCTCGGTCCACATTCAGCGAGAC

CTCGAGCTCCCGAGAGGAGAGCCCAGAACCCTATTTCTTCCGCCGGACCCCTGAACCCTCTGATGGGGAGGAGTCCCCAGAGCCAAGGCGTCCAAACTGG

ACCAGGCCCAGGGACTGGGAAGATGTAGAAGAGTCATCTAAATCAGACTTCGCTGAGTTTGGGGCCAAGAGGAAATTCACCCAGAGCTTCATGAGGTCTG

AAGAGGAGGGAGAGAAGGAGAGGACAGAAAACCGAGAGGAAGGGAGGTTTGCATCTGGGCGTCAGTCCCAGTATCGGAGAAGCACAAACCAGCAAGAGGA

AGAAGAAATGGATGATGAAGCCATCATTGCCGCCTGGAGAAAGCGGCAAGAGGAAACCAGAACCAAACTGCAAAGGAGGAGGGAGGACTGAGCGGAATGA

GGCCCTCCTTGGAGACACTGGGAACACGGAAAGAAGCCATTTAACACTGGGCTTGGGAACAGCTTACCATGACCTGCCAAGGGTTATGCAGGCTCTTCCA

TATGGGCAAAAATGCAAGCATCCAAGTAGAAAGGGCCTGGACAGTAGGGTGGAGAAGAGACAAGAGCCATTCATGCGAGCCCCAAATTCTGGACCAGCTT

ACACTTTCTATCACCAAAGGCCCTCTAAGCTTTCCTGTTTCCCTTCTAAGCTTTCCTGTTTCCCTTCTGCATTTGGTAGTGTCCACCACAGAGTGGAGAA

GTGAGTCTACAAAGCCACTGAGAAAGACCTGACTTGCAGGCTGTGGTTCTCTTCATTGAGGTTTCGCAATGAGACCCAGGTGATCCATTCTGTTGTGATT

CTGGCCTCTCCCTGCCAATGCTTGACTATCATGGCTTCTTTTCAATTAAATTGATATGCTGTC
Translation
 - UNI15615 - MATGGDAEEEQVVPNEEDEADVRAVQARYLRSPSPSQ - UNI9646 - - UNI15615 - QYSVVSEAETESIFMEPIHLSSA

VAAKQIINEE ELKPRGLRTDTECPGMLESAEQLLVEDLYNRVREKMDDRSLFNTPCVLDLQRALTQDRQEAPRNEVDEVWPNVFIAEK KSVAVNKGRL

KRLGITHILNAAHGTGVYTGSEFYTGLEIQYLGVEVDDFPEVDISQHFRKAAEFLDEALLTYRG GKVLVSSEMGISRSAVLVVAYLMIFHSMAILEALM

TVRRKRAIYPNDGFLKQLRELNEKLMEEREEEDGEEESEEDAGSMLGARVNSLMVEEEDDATSHLSGSSLGKASQVSKPVTLIDDEEEEKKLYEEWRKGQ

GFPKGEAAQGRKGRSCSMSSAQDGDDCEDEDVERIIQEWQSRNERYQAKGREQWNREEEEEEENSYSSRRRRHTLSESSASESVSSHDIRILKQQLERST

QSRRGRYRSDSESSESTWDMWNERLVEIEKEAARKYRSKSKREELDGDCSEAGGRVREDDEESVLSEASSFYNFCSRNKDKLTPLERWKIKRIQFGFHKK

DSEAGDGGSEHGTEEAAAGEKNLSDVNLTAYQAWKLKHQKKVGSENKEEVVEMSKGEDTVLAKKRQRRLELLERSRQTLEESQSMGSWEADSSTASRSIP

LSAFSSAAPSVSADGDTASVLSTQSHRSHASNMPATPLPNLPVGPGDTISIASIQNWIANVVNETLAQKQNEMLLLSRPPSVASMKAAPAACGLGGDDQL

SVLSTSLSGCLPPPSQGRPSSDVQSVLSSTSSLTSRAEGSGNKVRGTSKPIYSLFADNVDLKELGRKEKEMQMELQEKMSEYKMEKLASDNKRSSLFKKK

KAKDDEDMSVGDRDEDTDSAIGSFRYSSRSNSQKPETDASSSLAISDHYRNGRSMGNEMDSNINTWLSGLRMEEKSPPQSDWSGSSRGRYTRSSLLRETE

SKSCSYKFSKSRSQEQDTSFHEANGDTVRNTSRFSSSTTKEAREMHKFSRSTFSETSSSREESPEPYFFRRTPEPSDGEESPEPRRPNWTRPRDWEDVEE

SSKSDFAEFGAKRKFTQSFMRSEEEGEKERTENREEGRFASGRQSQYRRSTNQQEEEEMDDEAIIAAWRKRQEETRTKLQRRRED

For any suggestions or comments, please send an email to unitrap@crg.es