Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026565 (Pou2f1)
Chromosomal location
Chr 1: 167805616 - 167932765 (-)
Description
POU domain, class 2, transcription factor 1 Gene [Source:MGI Symbol;Acc:MGI:101898]
RefSeq_dna
NM_011137 NM_198934 NM_198933 
RefSeq_peptide
NP_035267.2 NP_945152.2 NP_945150.2 NP_945151.2 
UniGene
Mm.245261 
MGI
MGI:101898 
Uniprot/SWISSPROT
P25425 
Uniprot/SPTREMBL
Q8C4C1 Q7TSC9 
Human Ortholog
ENSG00000143190 (POU2F1)
Omim not available
UniTrap UNI397
Vector Insertion
Chr 1: 167932692 - 167932766
Public Clones GC1424 (tigem) AH0192 (sanger) AY0700 (sanger) DC0502 (sanger) AR0557 (sanger)
CJ0685 (sanger) XH201 (baygenomics) CSC064 (baygenomics) RRN295 (baygenomics)
CSJ313 (baygenomics) YHB238 (baygenomics) XK293 (baygenomics) CSI533 (baygenomics)
HMA394 (baygenomics) D072E01 (ggtc) A009C05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30226
Vector Insertion
Chr 1: 167864934 - 167932766
Public Clones (sanger) D072E01 (ggtc) IST13878E12 (tigm) IST14123F8 (tigm) IST13094B2 (tigm)
IST14968H2 (tigm) IST14278C4 (tigm) IST14188D1 (tigm) IST14276E10 (tigm)
IST14225A7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31919
Vector Insertion
Chr 1: 167861792 - 167865032
Public Clones IST14341G8 (tigm) IST14642G5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6039
Vector Insertion
Chr 1: 167861792 - 167861859
Public Clones YHD040 (baygenomics) LRY006 (baygenomics) XG888 (baygenomics) W092B01 (ggtc)
A046A05 (ggtc) A028B05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15913
Vector Insertion
Chr 1: 167847154 - 167861792
Public Clones not available
Private Clones OST470375 (lexicon) OST453679 (lexicon) OST448627 (lexicon) OST340007 (lexicon)
OST223159 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19367
Vector Insertion
Chr 1: 167845295 - 167847052
Public Clones not available
Private Clones OST393305 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22366
Vector Insertion
Chr 1: 167843481 - 167845240
Public Clones not available
Private Clones OST299168 (lexicon) OST171302 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI439
Vector Insertion
Chr 1: 167836911 - 167839010
Public Clones DC0676 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27884
Vector Insertion
Chr 1: 167827898 - 167832270
Public Clones not available
Private Clones OST45288 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15542
Vector Insertion
Chr 1: 167826567 - 167827898
Public Clones PST6625-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI830
Vector Insertion
Chr 1: 167825216 - 167826567
Public Clones CH0056 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2585
Vector Insertion
Chr 1: 167822047 - 167825035
Public Clones XS0142 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5754
Vector Insertion
Chr 1: 167813250 - 167821940
Public Clones CSI510 (baygenomics) CSH857 (baygenomics) YHC353 (baygenomics) A031B07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111429
Sequence
AAAATATTCAAAATGGCGGACGGAGGAGCAGCGAGTCAAGATGAGAGTTCAGCCGCGGCGGCAGCAGCAGCAG - UNI397 - - UNI6039 - - U

NI30226 - - UNI31919 - ACTCAAGAATGAATAATCCATCAGAAACCAATAAATCATCTATGGAGAGTGAAGATGCCAGCACAG - UNI6039 

- - UNI15913 - - UNI31919 - GCACACAAACCAATGGTCTGGACTTTCAGAAACAGCCCGTGCCCGTTGGAGGAGCGATCTCCACAGCCCAGG

CCCAGGCCTTCCTCGGACATCTTCACCAG - UNI19367 - GTCCAGCTAGCTGGGACAAGTTTACAGGCTGCTGCTCAGTCTTTAAATGTACAG - 

UNI22366 - TCTAAATCCAGTGAAGAGTCGGGAGATTCGCAGCAGTCGAGCCAGCCTTCTTCCCAGCCGCCTTCAGTGCAGTCAGCCATTCCCCAGAC

CCAGCTAATGCTGGCTGGGGGACAGATAACTGGG CTCACGTTGACCCCAGCCCAGCAACAGTTACTGCTACAGCAGGCGCAGGCCCAGGCCCAGCTCCT

GGCCGCTGCAGTGCAGCAACACTCCGCCAGCCAACAGCACAGTGCTGCTGGGGCCACCATCTCAGCCTCCGCCGCCACACCCATGACGCAGATCCCCCTG

TCTCAGCCCATACAGATTGCACAG GATCTTCAACAATTGCAACAGCTTCAGCAGCAAAATCTCAACTTGCAACAGTTTGTGTTGGTGCACCCAACCACC

AACCTGCAACCAGCACAGTTTATCATCTCACAGACCCCCCAGGGCCAGCAGG - UNI439 - GTCTCCTGCAAGCGCAAAATCTTTTAACGCAACTAC

CTCAGCAAAGCCAAGCCAACCTCCTACAGCCACAGCCAAGCATCACCCTCACGTCCCAG CCTACCACCCCAACTCGCACAATAGCAGCAGCCTCAGTTC

AGACACTTCCACAGAGCCAGTCAACACCAAAGCGAATTGACACTCCCAGCTTGGAGGAGCCCAGTGACCTTGAGGAGCTTGAGCAGTTTGCCAAGACTTT

CAAACAAAGACGAATCAAACTTGGATTCACTCAG - UNI15542 - - UNI27884 - GGTGATGTTGGGCTCGCTATGGGGAAATTATATGGAAAT

GACTTCAGCCAAACCACCATCTCTCGCTTTGAAGCCTTGAACCTCAGCTTTAAGAACATGTGCAAGTTAAAGCCCCTTTTAGAGAAGTGGCTAAATGATG

CAG - UNI15542 - AGAACCTCTCATCTGATTCTACAGCATCTAGCCCAAGTGCTTTGAATTCTCCAGGATTGGGGGCTGAGGGCTTGAATCGTAGG

AGGAAAAAACGCACCAGCATAGAGACCAACATCCGTGTGGCCTTAGAGAAGAGTTTCATGGAG - UNI830 - - UNI15542 - AATCAAAAGCCT

ACCTCGGAAGACATCACCTTGATTGCTGAACAGCTCAATATGGAAAAGGAGGTGATTCGTGTTTGGTTTTGTAACCGCCGCCAGAAGGAGAAAAGAATCA

ACCCGCCCAGCAGTGGTGGGACCAGCAGCTCACCTATCAAAGCAATTTTCCCCAGCCCAGCCTCATTG - UNI2585 - GTGGCAACCACTCCAAGCC

TTGTGACAAGCAGTACGGCAACTACCCTCACAGTCAACCCTGTCCTCCCTTTAACCAGTGCTGCTGTGACTAATCTCTCTCTTACAG - UNI5754 - 

ATCAAGATCTTAGAAGAGGATGCAGCTGGGAAGTGCTTAGGAGTCTACCAGACAGAGTCACCACCACAGCAG GCACTACAGACTCGACGTCCAACAACA

ACACGGCCACGGTGATTTCCACAGCACCCCCTGCTTCCTCAGCAGTCACATCCCCTTCCTTGAGTCCCTCTCCCTCTGCCTCGGCCTCCACCTCAGAGGC

CTCCAGTGCCAGTGAGACCAACACGACACAGACCACCTCCACGCCTCTTCCCTCCCCTCTCGGAGCCAGCCAGGTGATGGTGACCACGCCCGGCTTACAG

ACAGCAGCCGCCGCTCTCCAAGGAGCGGCACAGTTGCCAGCAAACGCCAGTCTTGCTGCTATGGCTGCTGCTGCGGGACTCAGCCCAGGCCTCATGGCAC

CCTCACAGTTTGCTGCTGG AGGTGCCTTACTCAGTCTCAGTCCGGGGACTCTGGGCAGTGCTCTCAGCCCAGCCCTAATGAGCAACAGTACACTGGCAA

CGATTCAAG GAGGAGCCCCGAACATCGTGACTGCACCTCTGTTCCTGAACCCTCAGAACCTCTCTCTGCTCACCAGCAACCCA GATTGCTTCATGGAT

TGGAGAACTTTCTAA
Translation
 - UNI397 - - UNI6039 - - UNI30226 - - UNI31919 - MNNPSETNKSSMESEDASTG - UNI6039 - - UNI15913 - - UN

I31919 - GTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQ - UNI19367 - VQLAGTSLQAAAQSLNVQ - UNI22366 - SKSSEESGDSQ

QSSQPSSQPPSVQSAIPQTQLMLAGGQITG LTLTPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASAATPMTQIPLSQPIQIAQ DLQQL

QQLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQGQQG - UNI439 - GLLQAQNLLTQLPQQSQANLLQPQPSITLTSQ PTTPTRTIAAASVQTLP

QSQSTPKRIDTPSLEEPSDLEELEQFAKTFKQRRIKLGFTQ - UNI15542 - - UNI27884 - GDVGLAMGKLYGNDFSQTTISRFEALNLSFKN

MCKLKPLLEKWLNDAE - UNI15542 - ENLSSDSTASSPSALNSPGLGAEGLNRRRKKRTSIETNIRVALEKSFME - UNI830 - - UNI1554

2 - NQKPTSEDITLIAEQLNMEKEVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPASL - UNI2585 - VATTPSLVTSSTATTLTVNPVLP

LTSAAVTNLSLTD - UNI5754 - DQDLRRGCSWEVLRSLPDRVTTTAG GTTDSTSNNNTATVISTAPPASSAVTSPSLSPSPSASASTSEASSASE

TNTTQTTSTPLPSPLGASQVMVTTPGLQTAAAALQGAAQLPANASLAAMAAAAGLSPGLMAPSQFAAG GGALLSLSPGTLGSALSPALMSNSTLATIQG

 GGAPNIVTAPLFLNPQNLSLLTSNP DCFMDWRTF
Transcript ENSMUST00000027850
Sequence
AAAATATTCAAAATGGCGGACGGAGGAGCAGCGAGTCAAGATGAGAGTTCAGCCGCGGCGGCAGCAGCAGCAG - UNI397 - - UNI6039 - - U

NI30226 - - UNI31919 - ACTCAAGAATGAATAATCCATCAGAAACCAATAAATCATCTATGGAGAGTGAAGATGCCAGCACAG - UNI6039 

- - UNI15913 - - UNI31919 - GCACACAAACCAATGGTCTGGACTTTCAGAAACAGCCCGTGCCCGTTGGAGGAGCGATCTCCACAGCCCAGG

CCCAGGCCTTCCTCGGACATCTTCACCAG - UNI19367 - GTCCAGCTAGCTGGGACAAGTTTACAGGCTGCTGCTCAGTCTTTAAATGTACAG - 

UNI22366 - TCTAAATCCAGTGAAGAGTCGGGAGATTCGCAGCAGTCGAGCCAGCCTTCTTCCCAGCCGCCTTCAGTGCAGTCAGCCATTCCCCAGAC

CCAGCTAATGCTGGCTGGGGGACAGATAACTGGG CTCACGTTGACCCCAGCCCAGCAACAGTTACTGCTACAGCAGGCGCAGGCCCAGGCCCAGCTCCT

GGCCGCTGCAGTGCAGCAACACTCCGCCAGCCAACAGCACAGTGCTGCTGGGGCCACCATCTCAGCCTCCGCCGCCACACCCATGACGCAGATCCCCCTG

TCTCAGCCCATACAGATTGCACAG GATCTTCAACAATTGCAACAGCTTCAGCAGCAAAATCTCAACTTGCAACAGTTTGTGTTGGTGCACCCAACCACC

AACCTGCAACCAGCACAGTTTATCATCTCACAGACCCCCCAGGGCCAGCAGG - UNI439 - GTCTCCTGCAAGCGCAAAATCTTTTAACGCAACTAC

CTCAGCAAAGCCAAGCCAACCTCCTACAGCCACAGCCAAGCATCACCCTCACGTCCCAG CCTACCACCCCAACTCGCACAATAGCAGCAGCCTCAGTTC

AGACACTTCCACAGAGCCAGTCAACACCAAAGCGAATTGACACTCCCAGCTTGGAGGAGCCCAGTGACCTTGAGGAGCTTGAGCAGTTTGCCAAGACTTT

CAAACAAAGACGAATCAAACTTGGATTCACTCAG - UNI15542 - - UNI27884 - GGTGATGTTGGGCTCGCTATGGGGAAATTATATGGAAAT

GACTTCAGCCAAACCACCATCTCTCGCTTTGAAGCCTTGAACCTCAGCTTTAAGAACATGTGCAAGTTAAAGCCCCTTTTAGAGAAGTGGCTAAATGATG

CAG - UNI15542 - AGAACCTCTCATCTGATTCTACAGCATCTAGCCCAAGTGCTTTGAATTCTCCAGGATTGGGGGCTGAGGGCTTGAATCGTAGG

AGGAAAAAACGCACCAGCATAGAGACCAACATCCGTGTGGCCTTAGAGAAGAGTTTCATGGAG - UNI830 - - UNI15542 - AATCAAAAGCCT

ACCTCGGAAGACATCACCTTGATTGCTGAACAGCTCAATATGGAAAAGGAGGTGATTCGTGTTTGGTTTTGTAACCGCCGCCAGAAGGAGAAAAGAATCA

ACCCGCCCAGCAGTGGTGGGACCAGCAGCTCACCTATCAAAGCAATTTTCCCCAGCCCAGCCTCATTG - UNI2585 - GTGGCAACCACTCCAAGCC

TTGTGACAAGCAGTACGGCAACTACCCTCACAGTCAACCCTGTCCTCCCTTTAACCAGTGCTGCTGTGACTAATCTCTCTCTTACAG - UNI5754 - 

ATCAAGATCTTAGAAGAGGATGCAGCTGGGAAGTGCTTAGGAGTCTACCAGACAGAGTCACCACCACAGCAG GCACTACAGACTCGACGTCCAACAACA

ACACGGCCACGGTGATTTCCACAGCACCCCCTGCTTCCTCAGCAGTCACATCCCCTTCCTTGAGTCCCTCTCCCTCTGCCTCGGCCTCCACCTCAGAGGC

CTCCAGTGCCAGTGAGACCAACACGACACAGACCACCTCCACGCCTCTTCCCTCCCCTCTCGGAGCCAGCCAGGTGATGGTGACCACGCCCGGCTTACAG

ACAGCAGCCGCCGCTCTCCAAGGAGCGGCACAGTTGCCAGCAAACGCCAGTCTTGCTGCTATGGCTGCTGCTGCGGGACTCAGCCCAGGCCTCATGGCAC

CCTCACAGTTTGCTGCTGG AGGTGCCTTACTCAGTCTCAGTCCGGGGACTCTGGGCAGTGCTCTCAGCCCAGCCCTAATGAGCAACAGTACACTGGCAA

CGATTCAAG CTCTTGCTTCTAGTGGCTCTCTTCCAATAACGTCTCTGGATGCAACTGGGAACCTGGTATTTGCCAATGCAGGAGGAGCCCCGAACATCG

TGACTGCACCTCTGTTCCTGAACCCTCAGAACCTCTCTCTGCTCACCAGCAACCCAGTAAGCTTGGTTTCTGCCGCTGCAGCCTCCACAGGGAACTCTGC

ACCTACAGCCAGCCTTCATGCCTCCTCCACCTCAACTGAGTCCATCCAGAGCTCTCTGTTCACAGTCGCCTCTGCCAGTGGGCCTGCTTCCACCACCACA

GCTGCCTCCAAGGCACAGTGAGCTGAGTGCAGAGCTGGGTTGCCACAGGCTTTCCTCACTACAGGGTGATAGGCTGGCTACCAGCTGCTTAAGAAAATGA

CACCTGTCATTGGCTTCCTCCCACCATGTTGTGAGGAGGAAGAAGACATGGAGAGAAGAAAAAATTACACATACCAGAAAAAGGAAAGAATGGAGACAGG

ACAGCATTTGCCTAATTTTATAATAAAACAATGTCTTTTCAGGATTGCTTCATGGATTGGAGAACTTTCTAACC
Translation
MADGGAASQDESSAAAAAAAD - UNI397 - - UNI6039 - - UNI30226 - - UNI31919 - DSRMNNPSETNKSSMESEDASTG - UNI

6039 - - UNI15913 - - UNI31919 - GTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQ - UNI19367 - VQLAGTSLQAAAQSLNVQ 

- UNI22366 - SKSSEESGDSQQSSQPSSQPPSVQSAIPQTQLMLAGGQITG LTLTPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISAS

AATPMTQIPLSQPIQIAQ DLQQLQQLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQGQQG - UNI439 - GLLQAQNLLTQLPQQSQANLLQPQPS

ITLTSQ PTTPTRTIAAASVQTLPQSQSTPKRIDTPSLEEPSDLEELEQFAKTFKQRRIKLGFTQ - UNI15542 - - UNI27884 - GDVGLAMG

KLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAE - UNI15542 - ENLSSDSTASSPSALNSPGLGAEGLNRRRKKRTSIETNIRVALEKS

FME - UNI830 - - UNI15542 - NQKPTSEDITLIAEQLNMEKEVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPASL - UNI2585 -

 VATTPSLVTSSTATTLTVNPVLPLTSAAVTNLSLTD - UNI5754 - DQDLRRGCSWEVLRSLPDRVTTTAG GTTDSTSNNNTATVISTAPPASSA

VTSPSLSPSPSASASTSEASSASETNTTQTTSTPLPSPLGASQVMVTTPGLQTAAAALQGAAQLPANASLAAMAAAAGLSPGLMAPSQFAAG GGALLSL

SPGTLGSALSPALMSNSTLATIQA ALASSGSLPITSLDATGNLVFANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASTGNSAPTASLHASSTS

TESIQSSLFTVASASGPASTTTAASKAQ
Transcript ENSMUST00000111427
Sequence
CCCCCTCCCCAAACGCTACCTGTTCCTTCTTGCTTTGGACTGTCTGCACCTCTTGAAGATTTTACAGCCATGCTGGACTGCAGTGACTGTGTTCTAG - 

UNI6039 - - UNI30226 - - UNI31919 - ACTCAAGAATGAATAATCCATCAGAAACCAATAAATCATCTATGGAGAGTGAAGATGCCAGCAC

AG - UNI6039 - - UNI15913 - - UNI31919 - GCACACAAACCAATGGTCTGGACTTTCAGAAACAGCCCGTGCCCGTTGGAGGAGCGATC

TCCACAGCCCAGGCCCAGGCCTTCCTCGGACATCTTCACCAG - UNI19367 - GTCCAGCTAGCTGGGACAAGTTTACAGGCTGCTGCTCAGTCTTT

AAATGTACAG - UNI22366 - TCTAAATCCAGTGAAGAGTCGGGAGATTCGCAGCAGTCGAGCCAGCCTTCTTCCCAGCCGCCTTCAGTGCAGTCAG

CCATTCCCCAGACCCAGCTAATGCTGGCTGGGGGACAGATAACTGGG CTCACGTTGACCCCAGCCCAGCAACAGTTACTGCTACAGCAGGCGCAGGCCC

AGGCCCAGCTCCTGGCCGCTGCAGTGCAGCAACACTCCGCCAGCCAACAGCACAGTGCTGCTGGGGCCACCATCTCAGCCTCCGCCGCCACACCCATGAC

GCAGATCCCCCTGTCTCAGCCCATACAGATTGCACAG GATCTTCAACAATTGCAACAGCTTCAGCAGCAAAATCTCAACTTGCAACAGTTTGTGTTGGT

GCACCCAACCACCAACCTGCAACCAGCACAGTTTATCATCTCACAGACCCCCCAGGGCCAGCAGG - UNI439 - GTCTCCTGCAAGCGCAAAATCTT

TTAACGCAACTACCTCAGCAAAGCCAAGCCAACCTCCTACAGCCACAGCCAAGCATCACCCTCACGTCCCAG CCTACCACCCCAACTCGCACAATAGCA

GCAGCCTCAGTTCAGACACTTCCACAGAGCCAGTCAACACCAAAGCGAATTGACACTCCCAGCTTGGAGGAGCCCAGTGACCTTGAGGAGCTTGAGCAGT

TTGCCAAGACTTTCAAACAAAGACGAATCAAACTTGGATTCACTCAG - UNI15542 - - UNI27884 - GGTGATGTTGGGCTCGCTATGGGGAA

ATTATATGGAAATGACTTCAGCCAAACCACCATCTCTCGCTTTGAAGCCTTGAACCTCAGCTTTAAGAACATGTGCAAGTTAAAGCCCCTTTTAGAGAAG

TGGCTAAATGATGCAG - UNI15542 - AGAACCTCTCATCTGATTCTACAGCATCTAGCCCAAGTGCTTTGAATTCTCCAGGATTGGGGGCTGAGGG

CTTGAATCGTAGGAGGAAAAAACGCACCAGCATAGAGACCAACATCCGTGTGGCCTTAGAGAAGAGTTTCATGGAG - UNI830 - - UNI15542 -

 AATCAAAAGCCTACCTCGGAAGACATCACCTTGATTGCTGAACAGCTCAATATGGAAAAGGAGGTGATTCGTGTTTGGTTTTGTAACCGCCGCCAGAAG

GAGAAAAGAATCAACCCGCCCAGCAGTGGTGGGACCAGCAGCTCACCTATCAAAGCAATTTTCCCCAGCCCAGCCTCATTG - UNI2585 - GTGGCA

ACCACTCCAAGCCTTGTGACAAGCAGTACGGCAACTACCCTCACAGTCAACCCTGTCCTCCCTTTAACCAGTGCTGCTGTGACTAATCTCTCTCTTACAG

 - UNI5754 - ATCAAGATCTTAGAAGAGGATGCAGCTGGGAAGTGCTTAGGAGTCTACCAGACAGAGTCACCACCACAGCAG GCACTACAGACTCG

ACGTCCAACAACAACACGGCCACGGTGATTTCCACAGCACCCCCTGCTTCCTCAGCAGTCACATCCCCTTCCTTGAGTCCCTCTCCCTCTGCCTCGGCCT

CCACCTCAGAGGCCTCCAGTGCCAGTGAGACCAACACGACACAGACCACCTCCACGCCTCTTCCCTCCCCTCTCGGAGCCAGCCAGGTGATGGTGACCAC

GCCCGGCTTACAGACAGCAGCCGCCGCTCTCCAAGGAGCGGCACAGTTGCCAGCAAACGCCAGTCTTGCTGCTATGGCTGCTGCTGCGGGACTCAGCCCA

GGCCTCATGGCACCCTCACAGTTTGCTGCTGG AGGTGCCTTACTCAGTCTCAGTCCGGGGACTCTGGGCAGTGCTCTCAGCCCAGCCCTAATGAGCAAC

AGTACACTGGCAACGATTCAAG CTCTTGCTTCTAGTGGCTCTCTTCCAATAACGTCTCTGGATGCAACTGGGAACCTGGTATTTGCCAATGCAGGAGGA

GCCCCGAACATCGTGACTGCACCTCTGTTCCTGAACCCTCAGAACCTCTCTCTGCTCACCAGCAACCCAGTAAGCTTGGTTTCTGCCGCTGCAGCCTCCA

CAGGGAACTCTGCACCTACAGCCAGCCTTCATGCCTCCTCCACCTCAACTGAGTCCATCCAGAGCTCTCTGTTCACAGTCGCCTCTGCCAGTGGGCCTGC

TTCCACCACCACAGCTGCCTCCAAGGCACAGTGAGCTGAGTGCAGAGCTGGGTTGCCACAGGCTTTCCTCACTACAGGGTGATAGGCTGGCTACCAGCTG

CTTAAGAAAATGACACCTGTCATTGGCTTCCTCCCACCATGTTGTGAGGAGGAAGAAGACATGGAGAGAAGAAAAAATTACACATACCAGAAAAAGGAAA

GAATGGAGACAGGACAGCATTTGCCTAATTTTATAATAAAACAATGTCTTTTCAGGATTGCTTCATGGATTGGAGAACTTTCTAACC
Translation
MLDCSDCVLD - UNI6039 - - UNI30226 - - UNI31919 - DSRMNNPSETNKSSMESEDASTG - UNI6039 - - UNI15913 - - 

UNI31919 - GTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQ - UNI19367 - VQLAGTSLQAAAQSLNVQ - UNI22366 - SKSSEESGD

SQQSSQPSSQPPSVQSAIPQTQLMLAGGQITG LTLTPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASAATPMTQIPLSQPIQIAQ DLQ

QLQQLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQGQQG - UNI439 - GLLQAQNLLTQLPQQSQANLLQPQPSITLTSQ PTTPTRTIAAASVQT

LPQSQSTPKRIDTPSLEEPSDLEELEQFAKTFKQRRIKLGFTQ - UNI15542 - - UNI27884 - GDVGLAMGKLYGNDFSQTTISRFEALNLSF

KNMCKLKPLLEKWLNDAE - UNI15542 - ENLSSDSTASSPSALNSPGLGAEGLNRRRKKRTSIETNIRVALEKSFME - UNI830 - - UNI15

542 - NQKPTSEDITLIAEQLNMEKEVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPASL - UNI2585 - VATTPSLVTSSTATTLTVNPV

LPLTSAAVTNLSLTD - UNI5754 - DQDLRRGCSWEVLRSLPDRVTTTAG GTTDSTSNNNTATVISTAPPASSAVTSPSLSPSPSASASTSEASSA

SETNTTQTTSTPLPSPLGASQVMVTTPGLQTAAAALQGAAQLPANASLAAMAAAAGLSPGLMAPSQFAAG GGALLSLSPGTLGSALSPALMSNSTLATI

QA ALASSGSLPITSLDATGNLVFANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASTGNSAPTASLHASSTSTESIQSSLFTVASASGPASTTT

AASKAQ
Transcript ENSMUST00000069609
Sequence
CCCCCTCCCCAAACGCTACCTGTTCCTTCTTGCTTTGGACTGTCTGCACCTCTTGAAGATTTTACAGCCATGCTGGACTGCAGTGACTGTGTTCTAG - 

UNI6039 - - UNI30226 - - UNI31919 - ACTCAAGAATGAATAATCCATCAGAAACCAATAAATCATCTATGGAGAGTGAAGATGCCAGCAC

AG - UNI6039 - - UNI15913 - - UNI31919 - GCACACAAACCAATGGTCTGGACTTTCAGAAACAGCCCGTGCCCGTTGGAGGAGCGATC

TCCACAGCCCAGGCCCAGGCCTTCCTCGGACATCTTCACCAG - UNI19367 - GTCCAGCTAGCTGGGACAAGTTTACAGGCTGCTGCTCAGTCTTT

AAATGTACAG - UNI22366 - TCTAAATCCAGTGAAGAGTCGGGAGATTCGCAGCAGTCGAGCCAGCCTTCTTCCCAGCCGCCTTCAGTGCAGTCAG

CCATTCCCCAGACCCAGCTAATGCTGGCTGGGGGACAGATAACTGGG CTCACGTTGACCCCAGCCCAGCAACAGTTACTGCTACAGCAGGCGCAGGCCC

AGGCCCAGCTCCTGGCCGCTGCAGTGCAGCAACACTCCGCCAGCCAACAGCACAGTGCTGCTGGGGCCACCATCTCAGCCTCCGCCGCCACACCCATGAC

GCAGATCCCCCTGTCTCAGCCCATACAGATTGCACAG GATCTTCAACAATTGCAACAGCTTCAGCAGCAAAATCTCAACTTGCAACAGTTTGTGTTGGT

GCACCCAACCACCAACCTGCAACCAGCACAGTTTATCATCTCACAGACCCCCCAGGGCCAGCAGG - UNI439 - GTCTCCTGCAAGCGCAAAATCTT

TTAACGCAACTACCTCAGCAAAGCCAAGCCAACCTCCTACAGCCACAGCCAAGCATCACCCTCACGTCCCAG CCTACCACCCCAACTCGCACAATAGCA

GCAGCCTCAGTTCAGACACTTCCACAGAGCCAGTCAACACCAAAGCGAATTGACACTCCCAGCTTGGAGGAGCCCAGTGACCTTGAGGAGCTTGAGCAGT

TTGCCAAGACTTTCAAACAAAGACGAATCAAACTTGGATTCACTCAG - UNI15542 - - UNI27884 - GGTGATGTTGGGCTCGCTATGGGGAA

ATTATATGGAAATGACTTCAGCCAAACCACCATCTCTCGCTTTGAAGCCTTGAACCTCAGCTTTAAGAACATGTGCAAGTTAAAGCCCCTTTTAGAGAAG

TGGCTAAATGATGCAG - UNI15542 - AGAACCTCTCATCTGATTCTACAGCATCTAGCCCAAGTGCTTTGAATTCTCCAGGATTGGGGGCTGAGGG

CTTGAATCGTAGGAGGAAAAAACGCACCAGCATAGAGACCAACATCCGTGTGGCCTTAGAGAAGAGTTTCATGGAG - UNI830 - - UNI15542 -

 AATCAAAAGCCTACCTCGGAAGACATCACCTTGATTGCTGAACAGCTCAATATGGAAAAGGAGGTGATTCGTGTTTGGTTTTGTAACCGCCGCCAGAAG

GAGAAAAGAATCAACCCGCCCAGCAGTGGTGGGACCAGCAGCTCACCTATCAAAGCAATTTTCCCCAGCCCAGCCTCATTG - UNI2585 - GTGGCA

ACCACTCCAAGCCTTGTGACAAGCAGTACGGCAACTACCCTCACAGTCAACCCTGTCCTCCCTTTAACCAGTGCTGCTGTGACTAATCTCTCTCTTACAG

 - UNI5754 - GCACTACAGACTCGACGTCCAACAACAACACGGCCACGGTGATTTCCACAGCACCCCCTGCTTCCTCAGCAGTCACATCCCCTTCCT

TGAGTCCCTCTCCCTCTGCCTCGGCCTCCACCTCAGAGGCCTCCAGTGCCAGTGAGACCAACACGACACAGACCACCTCCACGCCTCTTCCCTCCCCTCT

CGGAGCCAGCCAGGTGATGGTGACCACGCCCGGCTTACAGACAGCAGCCGCCGCTCTCCAAGGAGCGGCACAGTTGCCAGCAAACGCCAGTCTTGCTGCT

ATGGCTGCTGCTGCGGGACTCAGCCCAGGCCTCATGGCACCCTCACAGTTTGCTGCTGG AGGTGCCTTACTCAGTCTCAGTCCGGGGACTCTGGGCAGT

GCTCTCAGCCCAGCCCTAATGAGCAACAGTACACTGGCAACGATTCAAG CTCTTGCTTCTAGTGGCTCTCTTCCAATAACGTCTCTGGATGCAACTGGG

AACCTGGTATTTGCCAATGCAGGAGGAGCCCCGAACATCGTGACTGCACCTCTGTTCCTGAACCCTCAGAACCTCTCTCTGCTCACCAGCAACCCAGTAA

GCTTGGTTTCTGCCGCTGCAGCCTCCACAGGGAACTCTGCACCTACAGCCAGCCTTCATGCCTCCTCCACCTCAACTGAGTCCATCCAGAGCTCTCTGTT

CACAGTCGCCTCTGCCAGTGGGCCTGCTTCCACCACCACAGCTGCCTCCAAGGCACAGTGAGCTGAGTGCAGAGCTGGGTTGCCACAGGCTTTCCTCACT

ACAGGGTGATAGGCTGGCTACCAGCTGCTTAAGAAAATGACACCTGTCATTGGCTTCCTCCCACCATGTTGTGAGGAGGAAGAAGACATGGAGAGAAGAA

AAAATTACACATACCAGAAAAAGGAAAGAATGGAGACAGGACAGCATTTGCCTAATTTTATAATAAAACAATGTCTTTTCAGGATTGCTTCATGGATTGG

AGAACTTTCTAACC
Translation
MLDCSDCVLD - UNI6039 - - UNI30226 - - UNI31919 - DSRMNNPSETNKSSMESEDASTG - UNI6039 - - UNI15913 - - 

UNI31919 - GTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQ - UNI19367 - VQLAGTSLQAAAQSLNVQ - UNI22366 - SKSSEESGD

SQQSSQPSSQPPSVQSAIPQTQLMLAGGQITG LTLTPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASAATPMTQIPLSQPIQIAQ DLQ

QLQQLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQGQQG - UNI439 - GLLQAQNLLTQLPQQSQANLLQPQPSITLTSQ PTTPTRTIAAASVQT

LPQSQSTPKRIDTPSLEEPSDLEELEQFAKTFKQRRIKLGFTQ - UNI15542 - - UNI27884 - GDVGLAMGKLYGNDFSQTTISRFEALNLSF

KNMCKLKPLLEKWLNDAE - UNI15542 - ENLSSDSTASSPSALNSPGLGAEGLNRRRKKRTSIETNIRVALEKSFME - UNI830 - - UNI15

542 - NQKPTSEDITLIAEQLNMEKEVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPASL - UNI2585 - VATTPSLVTSSTATTLTVNPV

LPLTSAAVTNLSLTG - UNI5754 - GTTDSTSNNNTATVISTAPPASSAVTSPSLSPSPSASASTSEASSASETNTTQTTSTPLPSPLGASQVMVTT

PGLQTAAAALQGAAQLPANASLAAMAAAAGLSPGLMAPSQFAAG GGALLSLSPGTLGSALSPALMSNSTLATIQA ALASSGSLPITSLDATGNLVFAN

AGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASTGNSAPTASLHASSTSTESIQSSLFTVASASGPASTTTAASKAQ
Transcript ENSMUST00000111426
Sequence
CCCCCTCCCCAAACGCTACCTGTTCCTTCTTGCTTTGGACTGTCTGCACCTCTTGAAGATTTTACAGCCATGCTGGACTGCAGTGACTGTGTTCTAG - 

UNI6039 - - UNI30226 - - UNI31919 - ACTCAAGAATGAATAATCCATCAGAAACCAATAAATCATCTATGGAGAGTGAAGATGCCAGCAC

AG - UNI6039 - - UNI15913 - - UNI31919 - GCACACAAACCAATGGTCTGGACTTTCAGAAACAGCCCGTGCCCGTTGGAGGAGCGATC

TCCACAGCCCAGGCCCAGGCCTTCCTCGGACATCTTCACCAG - UNI19367 - - UNI22366 - TCTAAATCCAGTGAAGAGTCGGGAGATTCGC

AGCAGTCGAGCCAGCCTTCTTCCCAGCCGCCTTCAGTGCAGTCAGCCATTCCCCAGACCCAGCTAATGCTGGCTGGGGGACAGATAACTGGG CTCACGT

TGACCCCAGCCCAGCAACAGTTACTGCTACAGCAGGCGCAGGCCCAGGCCCAGCTCCTGGCCGCTGCAGTGCAGCAACACTCCGCCAGCCAACAGCACAG

TGCTGCTGGGGCCACCATCTCAGCCTCCGCCGCCACACCCATGACGCAGATCCCCCTGTCTCAGCCCATACAGATTGCACAG GATCTTCAACAATTGCA

ACAGCTTCAGCAGCAAAATCTCAACTTGCAACAGTTTGTGTTGGTGCACCCAACCACCAACCTGCAACCAGCACAGTTTATCATCTCACAGACCCCCCAG

GGCCAGCAGG - UNI439 - GTCTCCTGCAAGCGCAAAATCTTTTAACGCAACTACCTCAGCAAAGCCAAGCCAACCTCCTACAGCCACAGCCAAGCA

TCACCCTCACGTCCCAG CCTACCACCCCAACTCGCACAATAGCAGCAGCCTCAGTTCAGACACTTCCACAGAGCCAGTCAACACCAAAGCGAATTGACA

CTCCCAGCTTGGAGGAGCCCAGTGACCTTGAGGAGCTTGAGCAGTTTGCCAAGACTTTCAAACAAAGACGAATCAAACTTGGATTCACTCAG - UNI15

542 - - UNI27884 - GGTGATGTTGGGCTCGCTATGGGGAAATTATATGGAAATGACTTCAGCCAAACCACCATCTCTCGCTTTGAAGCCTTGAAC

CTCAGCTTTAAGAACATGTGCAAGTTAAAGCCCCTTTTAGAGAAGTGGCTAAATGATGCAG - UNI15542 - AGAACCTCTCATCTGATTCTACAGC

ATCTAGCCCAAGTGCTTTGAATTCTCCAGGATTGGGGGCTGAGGGCTTGAATCGTAGGAGGAAAAAACGCACCAGCATAGAGACCAACATCCGTGTGGCC

TTAGAGAAGAGTTTCATGGAG - UNI830 - - UNI15542 - AATCAAAAGCCTACCTCGGAAGACATCACCTTGATTGCTGAACAGCTCAATATG

GAAAAGGAGGTGATTCGTGTTTGGTTTTGTAACCGCCGCCAGAAGGAGAAAAGAATCAACCCGCCCAGCAGTGGTGGGACCAGCAGCTCACCTATCAAAG

CAATTTTCCCCAGCCCAGCCTCATTG - UNI2585 - GTGGCAACCACTCCAAGCCTTGTGACAAGCAGTACGGCAACTACCCTCACAGTCAACCCTG

TCCTCCCTTTAACCAGTGCTGCTGTGACTAATCTCTCTCTTACAG - UNI5754 - GCACTACAGACTCGACGTCCAACAACAACACGGCCACGGTGA

TTTCCACAGCACCCCCTGCTTCCTCAGCAGTCACATCCCCTTCCTTGAGTCCCTCTCCCTCTGCCTCGGCCTCCACCTCAGAGGCCTCCAGTGCCAGTGA

GACCAACACGACACAGACCACCTCCACGCCTCTTCCCTCCCCTCTCGGAGCCAGCCAGGTGATGGTGACCACGCCCGGCTTACAGACAGCAGCCGCCGCT

CTCCAAGGAGCGGCACAGTTGCCAGCAAACGCCAGTCTTGCTGCTATGGCTGCTGCTGCGGGACTCAGCCCAGGCCTCATGGCACCCTCACAGTTTGCTG

CTGG AGGTGCCTTACTCAGTCTCAGTCCGGGGACTCTGGGCAGTGCTCTCAGCCCAGCCCTAATGAGCAACAGTACACTGGCAACGATTCAAG CTCTT

GCTTCTAGTGGCTCTCTTCCAATAACGTCTCTGGATGCAACTGGGAACCTGGTATTTGCCAATGCAGGAGGAGCCCCGAACATCGTGACTGCACCTCTGT

TCCTGAACCCTCAGAACCTCTCTCTGCTCACCAGCAACCCAGTAAGCTTGGTTTCTGCCGCTGCAGCCTCCACAGGGAACTCTGCACCTACAGCCAGCCT

TCATGCCTCCTCCACCTCAACTGAGTCCATCCAGAGCTCTCTGTTCACAGTCGCCTCTGCCAGTGGGCCTGCTTCCACCACCACAGCTGCCTCCAAGGCA

CAGTGAGCTGAGTGCAGAGCTGGGTTGCCACAGGCTTTCCTCACTACAGGGTGATAGGCTGGCTACCAGCTGCTTAAGAAAATGACACCTGTCATTGGCT

TCCTCCCACCATGTTGTGAGGAGGAAGAAGACATGGAGAGAAGAAAAAATTACACATACCAGAAAAAGGAAAGAATGGAGACAGGACAGCATTTGCCTAA

TTTTATAATAAAACAATGTCTTTTCAGGATTGCTTCATGGATTGGAGAACTTTCTAACC
Translation
MLDCSDCVLD - UNI6039 - - UNI30226 - - UNI31919 - DSRMNNPSETNKSSMESEDASTG - UNI6039 - - UNI15913 - - 

UNI31919 - GTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQ - UNI19367 - - UNI22366 - SKSSEESGDSQQSSQPSSQPPSVQSAIP

QTQLMLAGGQITG LTLTPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASAATPMTQIPLSQPIQIAQ DLQQLQQLQQQNLNLQQFVLVH

PTTNLQPAQFIISQTPQGQQG - UNI439 - GLLQAQNLLTQLPQQSQANLLQPQPSITLTSQ PTTPTRTIAAASVQTLPQSQSTPKRIDTPSLEEP

SDLEELEQFAKTFKQRRIKLGFTQ - UNI15542 - - UNI27884 - GDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAE 

- UNI15542 - ENLSSDSTASSPSALNSPGLGAEGLNRRRKKRTSIETNIRVALEKSFME - UNI830 - - UNI15542 - NQKPTSEDITLIA

EQLNMEKEVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPASL - UNI2585 - VATTPSLVTSSTATTLTVNPVLPLTSAAVTNLSLTG - U

NI5754 - GTTDSTSNNNTATVISTAPPASSAVTSPSLSPSPSASASTSEASSASETNTTQTTSTPLPSPLGASQVMVTTPGLQTAAAALQGAAQLPAN

ASLAAMAAAAGLSPGLMAPSQFAAG GGALLSLSPGTLGSALSPALMSNSTLATIQA ALASSGSLPITSLDATGNLVFANAGGAPNIVTAPLFLNPQNL

SLLTSNPVSLVSAAAASTGNSAPTASLHASSTSTESIQSSLFTVASASGPASTTTAASKAQ
Transcript ENSMUST00000082225
Sequence
CCCCCTCCCCAAACGCTACCTGTTCCTTCTTGCTTTGGACTGTCTGCACCTCTTGAAGATTTTACAGCCATGCTGGACTGCAGTGACTGTGTTCTAG - 

UNI6039 - - UNI30226 - - UNI31919 - ACTCAAGAATGAATAATCCATCAGAAACCAATAAATCATCTATGGAGAGTGAAGATGCCAGCAC

AG - UNI6039 - - UNI15913 - - UNI31919 - GCACACAAACCAATGGTCTGGACTTTCAGAAACAGCCCGTGCCCGTTGGAGGAGCGATC

TCCACAGCCCAGGCCCAGGCCTTCCTCGGACATCTTCACCAG - UNI19367 - GTCCAGCTAGCTGGGACAAGTTTACAGGCTGCTGCTCAGTCTTT

AAATGTACAG - UNI22366 - TCTAAATCCAGTGAAGAGTCGGGAGATTCGCAGCAGTCGAGCCAGCCTTCTTCCCAGCCGCCTTCAGTGCAGTCAG

CCATTCCCCAGACCCAGCTAATGCTGGCTGGGGGACAGATAACTGGG CTCACGTTGACCCCAGCCCAGCAACAGTTACTGCTACAGCAGGCGCAGGCCC

AGGCCCAGCTCCTGGCCGCTGCAGTGCAGCAACACTCCGCCAGCCAACAGCACAGTGCTGCTGGGGCCACCATCTCAGCCTCCGCCGCCACACCCATGAC

GCAGATCCCCCTGTCTCAGCCCATACAGATTGCACAG GATCTTCAACAATTGCAACAGCTTCAGCAGCAAAATCTCAACTTGCAACAGTTTGTGTTGGT

GCACCCAACCACCAACCTGCAACCAGCACAGTTTATCATCTCACAGACCCCCCAGGGCCAGCAGG - UNI439 - GTCTCCTGCAAGCGCAAAATCTT

TTAACGCAACTACCTCAGCAAAGCCAAGCCAACCTCCTACAGCCACAGCCAAGCATCACCCTCACGTCCCAG - UNI15542 - - UNI27884 - G

GTGATGTTGGGCTCGCTATGGGGAAATTATATGGAAATGACTTCAGCCAAACCACCATCTCTCGCTTTGAAGCCTTGAACCTCAGCTTTAAGAACATGTG

CAAGTTAAAGCCCCTTTTAGAGAAGTGGCTAAATGATGCAG - UNI15542 - AGAACCTCTCATCTGATTCTACAGCATCTAGCCCAAGTGCTTTGA

ATTCTCCAGGATTGGGGGCTGAGGGCTTGAATCGTAGGAGGAAAAAACGCACCAGCATAGAGACCAACATCCGTGTGGCCTTAGAGAAGAGTTTCATGGA

G - UNI830 - - UNI15542 - AATCAAAAGCCTACCTCGGAAGACATCACCTTGATTGCTGAACAGCTCAATATGGAAAAGGAGGTGATTCGTGT

TTGGTTTTGTAACCGCCGCCAGAAGGAGAAAAGAATCAACCCGCCCAGCAGTGGTGGGACCAGCAGCTCACCTATCAAAGCAATTTTCCCCAGCCCAGCC

TCATTG - UNI2585 - GTGGCAACCACTCCAAGCCTTGTGACAAGCAGTACGGCAACTACCCTCACAGTCAACCCTGTCCTCCCTTTAACCAGTGCT

GCTGTGACTAATCTCTCTCTTACAG - UNI5754 - GCACTACAGACTCGACGTCCAACAACAACACGGCCACGGTGATTTCCACAGCACCCCCTGCT

TCCTCAGCAGTCACATCCCCTTCCTTGAGTCCCTCTCCCTCTGCCTCGGCCTCCACCTCAGAGGCCTCCAGTGCCAGTGAGACCAACACGACACAGACCA

CCTCCACGCCTCTTCCCTCCCCTCTCGGAGCCAGCCAGGTGATGGTGACCACGCCCGGCTTACAGACAGCAGCCGCCGCTCTCCAAGGAGCGGCACAGTT

GCCAGCAAACGCCAGTCTTGCTGCTATGGCTGCTGCTGCGGGACTCAGCCCAGGCCTCATGGCACCCTCACAGTTTGCTGCTGG AGGTGCCTTACTCAG

TCTCAGTCCGGGGACTCTGGGCAGTGCTCTCAGCCCAGCCCTAATGAGCAACAGTACACTGGCAACGATTCAAG CTCTTGCTTCTAGTGGCTCTCTTCC

AATAACGTCTCTGGATGCAACTGGGAACCTGGTATTTGCCAATGCAGGAGGAGCCCCGAACATCGTGACTGCACCTCTGTTCCTGAACCCTCAGAACCTC

TCTCTGCTCACCAGCAACCCAGTAAGCTTGGTTTCTGCCGCTGCAGCCTCCACAGGGAACTCTGCACCTACAGCCAGCCTTCATGCCTCCTCCACCTCAA

CTGAGTCCATCCAGAGCTCTCTGTTCACAGTCGCCTCTGCCAGTGGGCCTGCTTCCACCACCACAGCTGCCTCCAAGGCACAGTGAGCTGAGTGCAGAGC

TGGGTTGCCACAGGCTTTCCTCACTACAGGGTGATAGGCTGGCTACCAGCTGCTTAAGAAAATGACACCTGTCATTGGCTTCCTCCCACCATGTTGTGAG

GAGGAAGAAGACATGGAGAGAAGAAAAAATTACACATACCAGAAAAAGGAAAGAATGGAGACAGGACAGCATTTGCCTAATTTTATAATAAAACAATGTC

TTTTCAGGATTGCTTCATGGATTGGAGAACTTTCTAACC
Translation
MLDCSDCVLD - UNI6039 - - UNI30226 - - UNI31919 - DSRMNNPSETNKSSMESEDASTG - UNI6039 - - UNI15913 - - 

UNI31919 - GTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQ - UNI19367 - VQLAGTSLQAAAQSLNVQ - UNI22366 - SKSSEESGD

SQQSSQPSSQPPSVQSAIPQTQLMLAGGQITG LTLTPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASAATPMTQIPLSQPIQIAQ DLQ

QLQQLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQGQQG - UNI439 - GLLQAQNLLTQLPQQSQANLLQPQPSITLTSQ - UNI15542 - - 

UNI27884 - GDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAE - UNI15542 - ENLSSDSTASSPSALNSPGLGAEGLNR

RRKKRTSIETNIRVALEKSFME - UNI830 - - UNI15542 - NQKPTSEDITLIAEQLNMEKEVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAI

FPSPASL - UNI2585 - VATTPSLVTSSTATTLTVNPVLPLTSAAVTNLSLTG - UNI5754 - GTTDSTSNNNTATVISTAPPASSAVTSPSLS

PSPSASASTSEASSASETNTTQTTSTPLPSPLGASQVMVTTPGLQTAAAALQGAAQLPANASLAAMAAAAGLSPGLMAPSQFAAG GGALLSLSPGTLGS

ALSPALMSNSTLATIQA ALASSGSLPITSLDATGNLVFANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASTGNSAPTASLHASSTSTESIQSS

LFTVASASGPASTTTAASKAQ
Transcript ENSMUST00000111424
Sequence
AAAATATTCAAAATGGCGGACGGAGGAGCAGCGAGTCAAGATGAGAGTTCAGCCGCGGCGGCAGCAGCAGCAG - UNI397 - - UNI6039 - - U

NI30226 - - UNI31919 - ACTCAAGAATGAATAATCCATCAGAAACCAATAAATCATCTATGGAGAGTGAAGATGCCAGCACAG - UNI6039 

- - UNI15913 - - UNI31919 - GCACACAAACCAATGGTCTGGACTTTCAGAAACAGCCCGTGCCCGTTGGAGGAGCGATCTCCACAGCCCAGG

CCCAGGCCTTCCTCGGACATCTTCACCAG - UNI19367 - GTCCAGCTAGCTGGGACAAGTTTACAGGCTGCTGCTCAGTCTTTAAATGTACAG - 

UNI22366 - TCTAAATCCAGTGAAGAGTCGGGAGATTCGCAGCAGTCGAGCCAGCCTTCTTCCCAGCCGCCTTCAGTGCAGTCAGCCATTCCCCAGAC

CCAGCTAATGCTGGCTGGGGGACAGATAACTGGG CTCACGTTGACCCCAGCCCAGCAACAGTTACTGCTACAGCAGGCGCAGGCCCAGGCCCAGCTCCT

GGCCGCTGCAGTGCAGCAACACTCCGCCAGCCAACAGCACAGTGCTGCTGGGGCCACCATCTCAGCCTCCGCCGCCACACCCATGACGCAGATCCCCCTG

TCTCAGCCCATACAGATTGCACAG GATCTTCAACAATTGCAACAGCTTCAGCAGCAAAATCTCAACTTGCAACAGTTTGTGTTGGTGCACCCAACCACC

AACCTGCAACCAGCACAGTTTATCATCTCACAGACCCCCCAGGGCCAGCAGG - UNI439 - GTCTCCTGCAAGCGCAAAATCTTTTAACGCAACTAC

CTCAGCAAAGCCAAGCCAACCTCCTACAGCCACAGCCAAGCATCACCCTCACGTCCCAG CCTACCACCCCAACTCGCACAATAGCAGCAGCCTCAGTTC

AGACACTTCCACAGAGCCAGTCAACACCAAAGCGAATTGACACTCCCAGCTTGGAGGAGCCCAGTGACCTTGAGGAGCTTGAGCAGTTTGCCAAGACTTT

CAAACAAAGACGAATCAAACTTGGATTCACTCAG - UNI15542 - - UNI27884 - GGTGATGTTGGGCTCGCTATGGGGAAATTATATGGAAAT

GACTTCAGCCAAACCACCATCTCTCGCTTTGAAGCCTTGAACCTCAGCTTTAAGAACATGTGCAAGTTAAAGCCCCTTTTAGAGAAGTGGCTAAATGATG

CAG - UNI15542 - AGAACCTCTCATCTGATTCTACAGCATCTAGCCCAAGTGCTTTGAATTCTCCAGGATTGGGGGCTGAGGGCTTGAATCGTAGG

AGGAAAAAACGCACCAGCATAGAGACCAACATCCGTGTGGCCTTAGAGAAGAGTTTCATGGAG - UNI830 - - UNI15542 - AATCAAAAGCCT

ACCTCGGAAGACATCACCTTGATTGCTGAACAGCTCAATATGGAAAAGGAGGTGATTCGTGTTTGGTTTTGTAACCGCCGCCAGAAGGAGAAAAGAATCA

ACCCGCCCAGCAGTGGTGGGACCAGCAGCTCACCTATCAAAGCAATTTTCCCCAGCCCAGCCTCATTG - UNI2585 - GTGGCAACCACTCCAAGCC

TTGTGACAAGCAGTACGGCAACTACCCTCACAGTCAACCCTGTCCTCCCTTTAACCAGTGCTGCTGTGACTAATCTCTCTCTTACAG - UNI5754 - 

ATCAAGATCTTAGAAGAGGATGCAGCTGGGAAGTGCTTAGGAGTCTACCAGACAGAGTCACCACCACAGCAG GCACTACAGACTCGACGTCCAACAACA

ACACGGCCACGGTGATTTCCACAGCACCCCCTGCTTCCTCAGCAGTCACATCCCCTTCCTTGAGTCCCTCTCCCTCTGCCTCGGCCTCCACCTCAGAGGC

CTCCAGTGCCAGTGAGACCAACACGACACAGACCACCTCCACGCCTCTTCCCTCCCCTCTCGGAGCCAGCCAGGTGATGGTGACCACGCCCGGCTTACAG

ACAGCAGCCGCCGCTCTCCAAGGAGCGGCACAGTTGCCAGCAAACGCCAGTCTTGCTGCTATGGCTGCTGCTGCGGGACTCAGCCCAGGCCTCATGGCAC

CCTCACAGTTTGCTGCTGG CTCTTGCTTCTAGTGGCTCTCTTCCAATAACGTCTCTGGATGCAACTGGGAACCTGGTATTTGCCAATGCAGGAGGAGCC

CCGAACATCGTGACTGCACCTCTGTTCCTGAACCCTCAGAACCTCTCTCTGCTCACCAGCAACCCAGTAAGCTTGGTTTCTGCCGCTGCAGCCTCCACAG

GGAACTCTGCACCTACAGCCAGCCTTCATGCCTCCTCCACCTCAACTGAGTCCATCCAGAGCTCTCTGTTCACAGTCGCCTCTGCCAGTGGGCCTGCTTC

CACCACCACAGCTGCCTCCAAGGCACAGTGAGCTGAGTGCAGAGCTGGGTTGCCACAGGCTTTCCTCACTACAGGGTGATAGGCTGGCTACCAGCTGCTT

AAGAAAATGACACCTGTCATTGGCTTCCTCCCACCATGTTGTGAGGAGGAAGAAGACATGGAGAGAAGAAAAAATTACACATACCAGAAAAAGGAAAGAA

TGGAGACAGGACAGCATTTGCCTAATTTTATAATAAAACAATGTCTTTTCAGGATTGCTTCATGGATTGGAGAACTTTCTAACC
Translation
 - UNI397 - - UNI6039 - - UNI30226 - - UNI31919 - MNNPSETNKSSMESEDASTG - UNI6039 - - UNI15913 - - UN

I31919 - GTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQ - UNI19367 - VQLAGTSLQAAAQSLNVQ - UNI22366 - SKSSEESGDSQ

QSSQPSSQPPSVQSAIPQTQLMLAGGQITG LTLTPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASAATPMTQIPLSQPIQIAQ DLQQL

QQLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQGQQG - UNI439 - GLLQAQNLLTQLPQQSQANLLQPQPSITLTSQ PTTPTRTIAAASVQTLP

QSQSTPKRIDTPSLEEPSDLEELEQFAKTFKQRRIKLGFTQ - UNI15542 - - UNI27884 - GDVGLAMGKLYGNDFSQTTISRFEALNLSFKN

MCKLKPLLEKWLNDAE - UNI15542 - ENLSSDSTASSPSALNSPGLGAEGLNRRRKKRTSIETNIRVALEKSFME - UNI830 - - UNI1554

2 - NQKPTSEDITLIAEQLNMEKEVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPASL - UNI2585 - VATTPSLVTSSTATTLTVNPVLP

LTSAAVTNLSLTD - UNI5754 - DQDLRRGCSWEVLRSLPDRVTTTAG GTTDSTSNNNTATVISTAPPASSAVTSPSLSPSPSASASTSEASSASE

TNTTQTTSTPLPSPLGASQVMVTTPGLQTAAAALQGAAQLPANASLAAMAAAAGLSPGLMAPSQFAAG GSCF

For any suggestions or comments, please send an email to unitrap@crg.es