Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026584 (Scyl3)
Chromosomal location
Chr 1: 165859921 - 165885241 (+)
Description
SCY1-like 3 (S. cerevisiae) Gene [Source:MGI Symbol;Acc:MGI:1921385]
RefSeq_dna
NM_028776 
RefSeq_peptide
NP_083052.1 
MGI
MGI:1921385 
Uniprot/SWISSPROT
Q9DBQ7 
Uniprot/SPTREMBL
Q8C8F4 
Human Ortholog
ENSG00000000457 (SCYL3)
Omim not available
UniTrap UNI23151
Vector Insertion
Chr 1: 165860318 - 165863609
Public Clones (sanger)
Private Clones OST274746 (lexicon) OST90598 (lexicon) OST65842 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027876
Sequence
GGAAATGAACTCAAAAGCGGCTGGTTAAAAACCCAAACATGAAAACCGGGATGCCCCTGCAGTCGGGCTGAAGACACACGCAGAGAGGCTTCCCTGCCGC

CAGAGCCGGCTGCCGGGAACAGGCGTGCGGCGCAGGCTCCCCTGGCGCCCACACCTACCCGGGCCCGCGCCCTCGCAGCACCTGTGCGGCCGCTCTAGCT

CGGTTCCGGGTTCGCGCCTCGGTGGTGGCGTCGGAGGAACTGAAGGCCCGGCTGTTGAGCCGCTTCCGGGCCCTCGGAGAGCCGCCGGAGCCGGGTCCTC

GGGGGTGTCTGTGGGTGGAGGAGCCGGGGTCTGAGCGTCGGAGCCAGCCGCGGGCCAAGAGGGAGCGGAGCCGCCAGCCTCCTCCCGCCGCCCGCAG - 

UNI23151 - AGCTGTTTGGATTTGAGGAGGAGCTGCAGAACTGCCTCACGGCAACAGGGATGGGATCAGAGAACAGCGCTTTAAAGAGCTACACACTG

AGGGAGTCTCCTTTTACCTTACCATCTGGACTTGCTGTTTATCCCGCCATATTGCAAGATGGGAAATGTGCTTCCGTGTTTGTATATAAGCGAGAAAATG

AAGACAAGGTTAACAAGGCTGCCAAG CACTTAAAGACACTCCGTCACCCTTGCTTGCTAAGATTTTTATCTTGTACTGTGGAAGCAGATGGCATTCACC

TCGTCACTGAGAGAGTGCAGCCTCTGGAAGTGGCCTTGGAAACCCTGTCTCCTGCAGAAGTCTGTGCTGGAATCTATGACATACTGCTGGCTCTTATCTT

CCTTCATGACAGA GGACATTTGACACACAACAATGTCTGCCTGTCGTCTGTTTTTGTGAGTGAGGATGGGCACTGGAAGCTTGGAGGCATGGAGACTGT

TTGCCAAGTTCCTCAGGCCACGCCAGAG TTTCTCAGGAATATCCAGTCAGTAAGAGACCCAGCATCCATTCCTCCTGAGGAGATG TCTCCAGAATTTT

CAGGCCTTCCCGAGTCCCACGGCCACGCCCGGGATGCCTATGCCTTTGGAGCTTTGGTGGACAGCTTGCTCCCCATCTTCAATGAGCAGG TTTCAGCGG

ACGTTCTCTCCAGCTTCCTACAGATCCTGCACTCAGCTCTGCTGAACCCCATGCCCGAGTGTCGGCCAGCACTCAGCACCTTACTGTCCCATGATTTCTT

CAG AAATGATTTTCTAGAAGTTGTGAACTTCTTGAAAAGCTTGACATTAAAGAGTGAAGATGAAAAGACTGAATTTTTCAA ATTTCTGCTGGACCGAG

TGAGCTGCCTGTCAGAAGAATTAATAGCTTCAAGATTGGTGCCTCTTCTGCTTAACCAGCTGGTGTTTGCTGAGCCAGTAGCTGTTAAGAGCTTTCTTCC

CTATCTACTTGGTCCTAAAAAAG AGAACGCACCAGGAGAAACCCCTTGCTTGCTCTCGCCAGCGCTGTTCCAGTCCCGAGTGATCCCTGTGCTTCTCCG

GCTGTTCGAGGTGCACGAGGAGCACGTGCGGATGGTGTTACTGTCCCACATCGAGGCCTACGTGGAGCACTTCACTCAGGAACAGCTAAAGAAAGTCATC

CTGCCACAG GTACTACTGGGCCTTCGTGATACCAGCAATTCCATTGTGGCAATTACTCTCCGTAGCCTGGCAGTGCTGGTGTCTTTACTTGGACCAGAA

GTGGTTGTGGGAGGAGAACGAACCAAGATCTTTAAGCGCACCGCTCCAAGCTTCACCAAAACTAGTGACCTTTCCCCTGAAG GTTCTCCCATGCATGTT

GTCTGCAGCCAGCAGAGTCGGGTCTCAAAAGTCTTGGAGGACCCCTCGTCTAACGTATTCCCTAAATGGTTGTCTGGCAACGTGCCCAGCAGCAGCAGGA

AGCGCATACAGGAAGAATGTTACAGCTCTCTCTCACAGACAG GTGATCAGTTTTCTCACACCATTAAATTCCCTATGAATGGACTCTCAGATGTGAAAA

ACACTTCAGAGGACAATGGAAGCTTCCCTGCAGGTTCTAATAAGCCCGAGGAGTGGCCTGACTGGAGCGAGCCTGAGGAGCCTGAGCAGCAGCCTGCCAG

TATTCACAGATGGCCCCGAGAACCCTGTGATGTAGCAGAGTCCCAGCACACAAACCTGACCGCAGAGGAGGTGACCTGGGATGATGGTGAGGCTAGCTTT

GGCACTGAAATAAACTCAACAGCTACAGCCTCTGCTCCTGTGCCTGTTACCTCAGGGGGACAGTCAACCTCTGCAGCTTTGGTTCCTCTCACTGAAGAGT

CAAAGCCTTTGCAATCCAGTCCTTCCTCAAAGACCAGTCATAGACAGCATGAGGAAGTCAAACCACCCCAAGTGTCACAAGAAAGACCCCTGAAGGCTCC

GTCAGGACTTGGTTTGGGAGAAGAGTTTACCATTCAAGTAAAAAAGAAGCCAGTACAAGACCCGGAGTTGGACTGGTTTGCAGATATGATCCCAGAAATT

AAGCCTTCAGGTACTTTTCTTATTCTGCCTGAACTAAGGACAGAAGTGATGGTCCCTGACAAGGATAACGTCTCATCACTGATGCAGTTTTCCTCAAAGT

TTGCTGCAACAGAAATGACCGAG GGAGAGGCAGAAGGCTGGGAAGGAGAAGAGCTAGCCTGGGAAGATAACAACTGGTGACGATAATGAAAAGCTTCAG

GAAGAATTCTCAAAGAATTAATACCTCAAAGCAAGCTGCATGGATGCAAAACCCCAAAGCAGCTTGTGTTCCCCACACCAGGAGCTCTTTTTTGCAGTCT

GTGCCAAGTCAAGCAGAGACCAACCTCAGGTTGCTGACTAAGTCCTGGTGGCAAAAGGCTTCGGTGCCAGAGTCCAGGAGAAAGTGCTGTGTGCACTTGA

CTGAGGCCAGTTTCCATACAAAGCAAACAGCTAAAGAAGTGCTTTTTTCCAGGACAATTCTGGAAGAAATAAAAAATTCAAGCTGGTAAGCTTAATTTTG

TGCCATTTCTTTAAAAGAGTAAATTCTATTATGAAATAACTTAGTGGAAAAAGAAAACAAACAAACCTAGCTGTAAATTATAACTTCAGACTGCTAAGGC

TCCTTAGGCAGTTTGTCTGTTTACAGTCTGTCCCTCTCCTTCGGACCTGGGCAGTTACTGTTTCACCTGTATTACACTGGACCAAAGCTCTCAATGAGAA

ATACCCACCCTCATCTCCCATCTTGTTCTTTATGTCAAATAAAGATTATTTTCACATTTACAAAAGCTCTTTTATGTGCTATGAAAATATACAAACATAA

TTTACATTCACAATTTCATTTACAAAACACCCAGGCAGGCATCTGAAGAGTCAGCCCAGTTCTGTCGATACACAGGCCATTCATATTTTACCCTGTAAGC

ACACAGCGTTTTAGCTTCTCGATCCTTCCTTGCAGCGCCTCCAGTTCTGGCAGCAGCCATGCTGGAGCAAGAGAGTGTTTGAGTAAAAACTCAGTTGTCT

CCAAAGCCCTTGCTGCAGCTTTAAATACTGATCTGTATTCTTCTTCAAAGGGCAACACCCGACGGGCTCTCTTTGTGTGAGGCTGGAAAATAAGGAAATC

ATGAAACAAGTAATACATAATACTCATTCTAAAAATAATATAAGAGAAACTAGTCATAGGATCACGAAGAAGGCAGCCTTCCCATTTGTATTAACAATAA

CCTAAATGTGCTACTACTCTCCACGTCCTAACTTGTATGTGGCAGACAAGAAGTCGCACTGTGCAACGGTTCCCAATGATAAATGCTGTCTTGTCCAACA

ACTATCCACGAGTAGTCTTTAAAAACATCATTAAGGAAATAAAACATGAATTTCCTAATAAGTTTGTAAATGCTGAGAGCCATAATACCTTTCAACATAC

TTTTGGAGCCAATTAAGGAAAACTAAGGCTCCAGACATCTTGCATAGAAGGGGAAGAGGAACTGAGGTGAAACTAAAACATATCTTAACAACTAGTTTTT

CAAAGGGAAGTCACAGTTTAAATTCATAGGGCTTTCGAACACAACTGACTTAAATTGAACTTTATATATATTCAGGCCTACAGCTACATCCAAGAAAACA

AGTTACTATTGCACTATAAACCTAGAACATTGTTTTCCTTAGGACCCTATTCTATCACCTGTGTTCAAAACACAATTTTGAATGTATGTAGTCGTGTCAA

ATTTCTGCCAATTAATAGGTACATGTGATATTTGAGAAAAGTGATTATTATTGATGAGATGAATTGAACAAACTGACATCTAAGTGTCAGAAAATGCATT

TATGTCATCATTGGTACAATATGCAATTACCAATAATAAAGAGTATATTTGGT
Translation
 - UNI23151 - MGSENSALKSYTLRESPFTLPSGLAVYPAILQDGKCASVFVYKRENEDKVNKAAK HLKTLRHPCLLRFLSCTVEADGIHLVTERV

QPLEVALETLSPAEVCAGIYDILLALIFLHDR GHLTHNNVCLSSVFVSEDGHWKLGGMETVCQVPQATPE FLRNIQSVRDPASIPPEEM SPEFSGLP

ESHGHARDAYAFGALVDSLLPIFNEQV VSADVLSSFLQILHSALLNPMPECRPALSTLLSHDFFR RNDFLEVVNFLKSLTLKSEDEKTEFFK KFLLD

RVSCLSEELIASRLVPLLLNQLVFAEPVAVKSFLPYLLGPKKE ENAPGETPCLLSPALFQSRVIPVLLRLFEVHEEHVRMVLLSHIEAYVEHFTQEQLK

KVILPQ VLLGLRDTSNSIVAITLRSLAVLVSLLGPEVVVGGERTKIFKRTAPSFTKTSDLSPEG GSPMHVVCSQQSRVSKVLEDPSSNVFPKWLSGNV

PSSSRKRIQEECYSSLSQTG GDQFSHTIKFPMNGLSDVKNTSEDNGSFPAGSNKPEEWPDWSEPEEPEQQPASIHRWPREPCDVAESQHTNLTAEEVTW

DDGEASFGTEINSTATASAPVPVTSGGQSTSAALVPLTEESKPLQSSPSSKTSHRQHEEVKPPQVSQERPLKAPSGLGLGEEFTIQVKKKPVQDPELDWF

ADMIPEIKPSGTFLILPELRTEVMVPDKDNVSSLMQFSSKFAATEMTE GEAEGWEGEELAWEDNNW

For any suggestions or comments, please send an email to unitrap@crg.es