Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026592 (1700057K13Rik)
Chromosomal location
Chr 1: 159029278 - 159038811 (-)
Description
RIKEN cDNA 1700057K13 gene Gene [Source:MGI Symbol;Acc:MGI:1920685]
RefSeq_peptide
NP_082816.1 
UniGene
Mm.116705 
MGI
MGI:1920685 
Uniprot/SWISSPROT
Q14BK3 
Human Ortholog
ENSG00000184909 (C1orf49)
Omim not available
UniTrap UNI28929
Vector Insertion
Chr 1: 159030656 - 159034474
Public Clones not available
Private Clones OST15789 (lexicon)
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027884
Sequence
AAGTTACATAAGTCGGTGGCCCAGTCCTAAGGGACTGTTGTGGGGAGGTTGGGAAGTTGAAGAACACCTAGCCCTTCCATCATGTCAGCCAAGAATGCAG

AACTGAAGAAAACTAACCTG AAAAAGAACTACAAGGCTGTTTGCATGGAACCGAAGCTGACACAA ATATATGATTTCAAAGGATTTAAACAAGAAGGG

CTACTCATCAGAAAAGGGATGACGCGGGAGCTGAAG AACGAACTCAGGGAGGTGAGAGAACAACTCACGGAAAAAATGGAAGAGATAAAACAG ATAAA

GGATATAATGGACAAAGATTTCGATAAACTTTATGAGTTTGTGGAAATTATGAAG - UNI28929 - GAAATGCAGCAGGATATGGACGAAAAGATGG

ATGTTTTAATTAATAATCAGAAGAACAACAAGCT TCCCTTTCAAAACCAAGCCAAGGAGCAGCAGAAATTCTGGCAGCTAGGAAAGATGGACAAAGGCT

CCCAAGCCATGATCACAGAAGAACCCGATGGAGCACCATTGGCTTGTGACAAGAATGTGGTGCCACCAAAACCAACGAGGAATCCACTGGAGTCCCTCCA

TCCATGTCAGAGTTGCTGC GAGAAATGTTTGTTGTGTGCCCTAAAGACCAACCGCAATCAGGG GAGACCTTCACACCATGCCTGGGTGCCTTTTTCAC

CCTTGTCGTCTGGAGCTGCTTTCTAATTTATCTGTACTTCAACTTCGCCGAGGTGGAGCATGTGCTGCCGACCTAGCACAGCCATGGAGCCTACCACCAG

CTCCAACTCATCATCTCCTGACTCCTGAGCTACACAGCAGACTTTTCTGCCCTCTTAAACACCCTCCAACCCCCACCCCTGCCCAGGCTTCCACCTGGAA

ATTAAAGAATCTCATTTAAAGC
Translation
MSAKNAELKKTNL KKNYKAVCMEPKLTQ IYDFKGFKQEGLLIRKGMTRELK NELREVREQLTEKMEEIKQ IKDIMDKDFDKLYEFVEIMK - UNI

28929 - EMQQDMDEKMDVLINNQKNNKL LPFQNQAKEQQKFWQLGKMDKGSQAMITEEPDGAPLACDKNVVPPKPTRNPLESLHPCQSCC EKCLLC

ALKTNRNQG GRPSHHAWVPFSPLSSGAAF
Transcript ENSMUST00000118207
Sequence
ACATAAGTCGGTGGCCCAGTCCTAAGGGACTGTTGTGGGGAGGTTGGGAAGTTGAAGAACACCTAGCCCTTCCATCATGTCAGCCAAGAATGCAGAACTG

AAGAAAACTAACCTG AAAAAGAACTACAAGGCTGTTTGCATGGAACCGAAGCTGACACAA ATATATGATTTCAAAGGATTTAAACAAGAAGGGCTACT

CATCAGAAAAGGGATGACGCGGGAGCTGAAG AACGAACTCAGGGAGGTGAGAGAACAACTCACGGAAAAAATGGAAGAGATAAAACAG ATAAAGGATA

TAATGGACAAAGATTTCGATAAACTTTATGAGTTTGTGGAAATTATGAAG - UNI28929 - GAAATGCAGCAGGATATGGACGAAAAGATGGATGTT

TTAATTAATAATCAGAAGAACAACAAGCT TCCCTTTCAAAACCAAGCCAAGGAGCAGCAGAAATTCTGGCAGCTAGGAAAGATGGACAAAGGCTCCCAA

GCCATGATCACAGAAGAACCCGATGGAGCACCATTGGCTTGTGACAAGAATGTGGTGCCACCAAAACCAACGAGGAATCCACTGGAGTCCCTCCATCCAT

GTCAGAGTTGCTGC GAGAAATGTTTGTTGTGTGCCCTAAAGACCAACCGCAATCAGGG CAGGAGACCTTCACACCATGCCTGGGTGCCTTTTTCACCC

TTGTCGTCTGGAGCTGCTTTCTAATTTATCTGTACTTCAACTTCGCCGAGGTGGAGCATGTGCTGCCGACCTAGCACAGCCATGGAGCCTACCACCAGCT

CCAACTCATCATCTCCTGACTCCTGAGCTACACAGCAGACTTTTCTGCCCTCTTAAACACCCTCCAACCCCCACCCCTGCCCAGGCTTCCACCTGGAAAT

TAAAGAATCTCATTTAAAG
Translation
MSAKNAELKKTNL KKNYKAVCMEPKLTQ IYDFKGFKQEGLLIRKGMTRELK NELREVREQLTEKMEEIKQ IKDIMDKDFDKLYEFVEIMK - UNI

28929 - EMQQDMDEKMDVLINNQKNNKL LPFQNQAKEQQKFWQLGKMDKGSQAMITEEPDGAPLACDKNVVPPKPTRNPLESLHPCQSCC EKCLLC

ALKTNRNQG GRRPSHHAWVPFSPLSSGAAF
Transcript ENSMUST00000121911
Sequence
GGTGGTCAACCTGCACTTGCCTAAGCCT AAAAAGAACTACAAGGCTGTTTGCATGGAACCGAAGCTGACACAA ATATATGATTTCAAAGGATTTAAAC

AAGAAGGGCTACTCATCAGAAAAGGGATGACGCGGGAGCTGAAG AACGAACTCAGGGAGGTGAGAGAACAACTCACGGAAAAAATGGAAGAGATAAAAC

AG ATAAAGGATATAATGGACAAAGATTTCGATAAACTTTATGAGTTTGTGGAAATTATGAAG - UNI28929 - GAAATGCAGCAGGATATGGACGA

AAAGATGGATGTTTTAATTAATAATCAGAAGAACAACAAGCT TCCCTTTCAAAACCAAGCCAAGGAGCAGCAGAAATTCTGGCAGCTAGGAAAGATGGA

CAAAGGCTCCCAAGCCATGATCACAGAAGAACCCGATGGAGCACCATTGGCTTGTGACAAGAATGTGGTGCCACCAAAACCAACGAGGAATCCACTGGAG

TCCCTCCATCCATGTCAGAGTTGCTGC GAGAAATGTTTGTTGTGTGCCCTAAAGACCAACCGCAATCAGGG CAGGAGACCTTCACACCATGCCTGGGT

GCCTTTTTCACCCTTGTCGTCTGGAGCTGCTTTCTAATTTATCTGTACTTCAACTTCGCCGAGGTGGAGCATGTGCTGCCGACCTAGCACAGCCATGGAG

CCTACCACCAGCTCCAACTCATCATCTCCTGACTCCTGAGCTACACAGCAGACTTTTCTGCCCTCTTAAACACCCTCCAACCCCCACCCCTGCCCAGGCT

TCCACCTGGAAATTAAAGAATCTCAT
Translation
 MEPKLTQ IYDFKGFKQEGLLIRKGMTRELK NELREVREQLTEKMEEIKQ IKDIMDKDFDKLYEFVEIMK - UNI28929 - EMQQDMDEKMDVL

INNQKNNKL LPFQNQAKEQQKFWQLGKMDKGSQAMITEEPDGAPLACDKNVVPPKPTRNPLESLHPCQSCC EKCLLCALKTNRNQG GRRPSHHAWVP

FSPLSSGAAF
Transcript ENSMUST00000119526
Sequence
GGAATAGGTGTGAAACTGGTTCCTGGCCTTGGCGAGGAGGGAAAGAGGCCCACACTGCTCCCAT AAAAAGAACTACAAGGCTGTTTGCATGGAACCGAA

GCTGACACAA ATATATGATTTCAAAGGATTTAAACAAGAAGGGCTACTCATCAGAAAAGGGATGACGCGGGAGCTGAAG AACGAACTCAGGGAGGTGA

GAGAACAACTCACGGAAAAAATGGAAGAGATAAAACAG ATAAAGGATATAATGGACAAAGATTTCGATAAACTTTATGAGTTTGTGGAAATTATGAAG 

- UNI28929 - GAAATGCAGCAGGATATGGACGAAAAGATGGATGTTTTAATTAATAATCAGAAGAACAACAAGCT TCCCTTTCAAAACCAAGCCAA

GGAGCAGCAGAAATTCTGGCAGCTAGGAAAGATGGACAAAGGCTCCCAAGCCATGATCACAGAAGAACCCGATGGAGCACCATTGGCTTGTGACAAGAAT

GTGGTGCCACCAAAACCAACGAGGAATCCACTGGAGTCCCTCCATCCATGTCAGAGTTGCTGC GAGAAATGTTTGTTGTGTGCCCTAAAGACCAACCGC

AATCAGGG GAGACCTTCACACCATGCCTGGGTGCCTTTTTCACCCTTGTCGTCTGGAGCTGCTTTCTAATTTATCTGTACTTCAACTTCGCCGAGGTGG

Translation
 MEPKLTQ IYDFKGFKQEGLLIRKGMTRELK NELREVREQLTEKMEEIKQ IKDIMDKDFDKLYEFVEIMK - UNI28929 - EMQQDMDEKMDVL

INNQKNNKL LPFQNQAKEQQKFWQLGKMDKGSQAMITEEPDGAPLACDKNVVPPKPTRNPLESLHPCQSCC EKCLLCALKTNRNQG GRPSHHAWVPF

SPLSSGAAF

For any suggestions or comments, please send an email to unitrap@crg.es