Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026609 (Ush2a)
Chromosomal location
Chr 1: 190085914 - 190788920 (+)
Description
Usher syndrome 2A (autosomal recessive, mild) homolog (human) Gene [Source:MGI (curated);Acc:Ush2a-001]
RefSeq_dna
NM_021408 
RefSeq_peptide
NP_067383.3 
UniGene
Mm.331238 
MGI
MGI:1341292 
Uniprot/SWISSPROT
Q2QI47 
Uniprot/SPTREMBL
Q1KPK2 Q9D1Z8 
Human Ortholog
ENSG00000042781 (USH2A)
Omim 268000 - RETINITIS PIGMENTOSA  276901 - USHER SYNDROME, TYPE IIA  
UniTrap UNI31634
Vector Insertion
Chr 1: 190142973 - 190174915
Public Clones IST10219E9 (tigm) IST13719H2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35741
Vector Insertion
Chr 1: 190452594 - 190457459
Public Clones IST11071E2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027905
Sequence
ATGCATTACCTGGCTCTCTCACCGGGCTTCCTGTGTTACACCATTAAAACATTGATCCTTGCCTATTTGGCTTCGGTATTGGTGTTGGCTGCCTCACAGG

GCGTTTTCCCAAGGCTGGAGAATGTGGGTGCTTTCAGGAAGGTATCCACTGTGCCAACCCACGCCACGTGTGGATTCCCAGGCCCTAGCACTTTTTGTCG

TAGCCCGGTGGCGGCTGAGCATGTGCAACTGTGTACGGAGAGGCTGTGTATCCAGGATTGCCCCTACCGCTCTGCCTCTCCTCTCTATACTGCCCTCCTA

GAAGGCCTCCGGAGCTGCATCCCTGCAGACGACGGTGATCTCCACCCTTACTCCAGGAGCAGCTCCGTGAGCTTCATGTTCGGAAGTCACCAGAACTGCC

CGTCTCTACGGGCTCCGAGGCTGGCAGCCGAATTGACCTTAGCTGTGTGGTTGAAGCTTGAGCAAGGAGGCACTAT GTGTGTGATAGAAAAGACAGTGG

ACGGGCAGATTGTGTTCAAAGTTACAATATCTGAGAAAGAGACCATGTTTTATTATCGCACAGTAAATGGTTTGCAGCCTCCAATAAAAGTAATGACACC

AGGGAGAATTCTTATGAAGAAATGGATTCATCTCACTGTGCAG GTGCATCAGACGGCAATCAGCTTCTTTGTGGACGGTCTGGAGGAGAACAGTACTGC

ATTTGATACAAGAACTCTCCATGATTCAGTCACAGACTCAGTCTCCAGCGTGATACAAGTAGGACAGAGTTTAAATG - UNI31635 - GTTCAGAGC

AGTTTGTTGGAAGAATGCAAGATTTTCGATTGTACAATGTGTCACTTACAAACAG GGAGATTCTAGAGGTCTTTTCTGGAGATTTTCCTCACTTGCACA

TCCAGCCACATTGCCGATGTCCAGGTAGCCACCCCCGTGTCCACCCCTCCGTTCAGCAGTACTGCATTCCCAATGGTGCAGGAGACACGCCCGAGCATCG

AATGTCACGGCTGAATCCCGAAGCCCACCCTCTCTCCTTCATCAATGATGACGACGTTGCTACTTCATGGATCTCTCATGTGTTTACAAACATTACGCAG

CTCTATGAAGGAGTGGCTATTTCTATAGACTTAGAAAATGGACAGTACCAG GTGCTTAAAGTCATCACCCAGTTCTCCAGCCTACAGCCTGTGGCAATT

CGGATCCAGAGGAAGAAGGCAGACAGCTCTCCCTGGGAGGACTGGCAGTATTTTGCCAGAAATTGCAGTGTTTGGGGAATGAAGGACAATGAAGATTTGG

AAAATCCCAATTCTGTCAACTGTCTCCAGCTTCCTGA TTTTATCCCGTTTTCCCATGGTAATGTCACCTTTGACCTCCTGACATCTGGACAGAAGCATC

GTCCTGGGTACAACGACTTTTACAACAGCTCAGTGCTTCAAGAATTCATGAGAGCCACTCAAATAAGGCTGCACTTCCATGGGCAGTACTATCCGGCTGG

ACACACTGTTGACTGGAGACACCAATACTATGCAGTGGATGAGATCATTGTCAGTGGAAG ATGCCAATGCCACGGCCATGCTGAGACCTGTGACAGGAC

CAGACGGCCTTACAGATGTCTCTGCTCTCCACACAGCTTCACTGAAGGGCCTCAG TGTGATCGATGCTCCCCTCTTTATAATGACAAGCCTTTCCGCAG

TGGTGACAATGTTAATGCATTCAACTGTAAGCCTTGCCAGTGCCATGGCCATGCCAGCAGCTGCCACTACGATGCTTCTGTGGACCCATTTCCCCTGGAA

CACAACAGAGGCGGTGGAGGAGTCTGTGATGACTGTCAGCATCATACAACAG GGAGACACTGTGAGTCGTGCCAGGATTACTTTTACCGACCTGTTGGT

GCTGATCCTGCTGCCCCGGATGCTTGCAAGCTCTGTGACTGTAACAGGGCCGGGACTAGAAATGGCAGCCTCCACTGTGACCCG ATTGGAGGCCAATGT

GATTGTAAGAGACGTGTGTCTGGCAGACAGTGCCTTCAGTGCCAGGATGGATTCTATGACCTGCAGGCGCTAGATCCTGACGGCTGCCGTCCCTGTAACT

GTAATCCCTCTGGGACCGTGGATGGAGACATTACCTGTCACCAAAATTCAGGCCAGTGCTCGTGCAAAGCGAATGTTATTG GGCTTAGATGCAATCGCT

GCAATTTCGGATTTAAATTCCTCCAGAGTTTTAATGGTGATGGATGTGAGCCTTGCCAATGTAACCTCCACGGCTCAGTGAACCAACTCTGTGATCCGCT

TTCTGGGCAGTGTGCATGCAAGAAGGAAGCCAAAGGACTTAAGTGTGACTCTTGCAGAGAAAACTTTTATGGGTTGCCCTGGAGTGCTTGTGAGGTCTGT

GACTGCAGCAAGGCTGGGTCCCAGCCTGGGACTGTCTGTGACACTGAGACAGGGCAGTGCGTTTGTAAGCCCAATGTTGGAGGGAGACAATGTAGTCAGT

GTAAGGCAGGCTACTTCAACCTATATCAGAATGATTCCCACCTCTGTTTGACTTGTAACTGCGAGAAGATGGGAACGGTAAATGGCTCTCTAAGGTGTGA

CAAGTCAACCGGGCAGTGTCCTTGCAAACTAGGGGTAACTGGTCTGCGTTGCCACCAGTGCAAGCCTCACAGGTTCAATTTGACGATGGACAATCCTCAA

GGTTGTCAGGCGTGCGACTGTGACTCGTTGGGGACATTACCTGGAAGCATGTGTGACCCCATCAGTGGCCAGTGTCTATGTCTACCTCATCGACAAGGAA

GAAGGTGTGAGCAGTGTCAGCCAG GCTTTTACAGTTCTCCCAGCAATGCCACTGGCTGCCTGCCATGCTTATGCCACACAGCTGGTGCTGTGAGCCACA

TCTGTAATAGTGTCACGGGACAGTGCTCTTGCCATGACCCCTCAACCACTGGGCGTAGCTGTCACCAGTGTCAAGAAAGTTACTTTAGATTTGATCCCCT

GACTGGAAG ATGCAGGCCTTGTCACTGTCATGTAGCAGGAGCCTCGAATGGAACTTGTGATGCAGTCACAGGCCAGTGTTTCTGCAAAGAGTTTGTCAC

TGGCTCAAAATGTGACACTTGTGTTCCTGGTGCAAGCCACTTGGACGTCAACAATCTATTAGGCTGCAGCAAAA CTCCATCTCAGCAACCTCCACCCAG

AGGATGGGTTCAGAGTTCTTCTACCATCAATGTGTCCTGGAGTCCACCCGAGTGCCCAAATGCTCACTGGCTTACATACACTCTGTTCAGGAATGGCTCT

GAGATCTACACAACTGAAGATGAACACCCGTACT ATACTCAGTACTTCTTAGACACTAGTCTGTCACCACACACAGCATATTCATATTATATAGAGACC

TCCAATGTGCACAGTTCGACAAGGAGCATACCTGTCATTTATGAGACAAAGCCAGAGGTCTCAGAAGGACACTTGAACTTGACTCACATCATTCCTGTGG

GCTCGGACTCCATTACACTTACCTGGACTGGACTCTCCAACAGCTCTGATCCTGTGGCAAAATATGTTTTATCATGCACACCTGTGGACAGCACTGAGCC

CTGTGTCTCCTATGAAGGTCCAGAAACCTCAGCTACCATCTGGAATCTGGTTCCATTCACCCAGTACTGTTTTTCTGTCCAGGGCTGTACTAATGAGAGC

TGTTTCTACAGCTTGCCTATTATAGTAACCACAGCCCAAGCACCTCCTCAAACGCAGGGGCCACCTACAGTATGGAAAATCAGTCCCACAGAACTCAGAA

TAGAATGGTCTCCTCCAGTGGACTCAAATG GTATAATTATAAGCTATGAGTTATACATGAGGAGATGGCTGTCCACCGAAGAAAGCCTAGTGTTTGAGA

GCCACGGTTTGGTCAGTTCTCACTCAGCTTTACAGTCGGTCAATCCGAGTAAGAACCTGCTCCAGCAGCCCCAAGCCAGCACGTTCATCTCTGGCTTGGA

GCCACACACAGAGTATGCATTTAGGGTCTTGGCTGTGAATATGGCTGGCAGGGTGTCGTCTGCCTGGGCCTCAGAAAGAACGGGGGAATCAG TACCCGT

ATTCATGGCCCCTCCTTCAGTCTCTCCACTCTCACCACACTCCCTCAGTGTCTCCTGGGAGAAGCCAGCAGAAAACTTTACAAGAGGAGAAATTATAGGG

TACAAGATCAGCATGGTTTCTGAACATTTCCCTCTACACGATGTTCCAGTCATGTGCTCAAAG ATGGTGCATTTTGCTAAGTCCCAAGACCAGTCTTAC

ATCGTAAGGGGACTCGAGCCTTATAGGACCTACAGCTTCACAGTGTCCCTCTGCGATTCCGTGGGCTGTGTAACCAGTGCTTTGGGATCAGGACAAACCT

TAGCAGCAG CTCCTGCTCAGCTCCGGCCTCCCATGGTGACAGGAGTCAACAGTACTACAGTCCATATCAGGTGGCTTCCTCCTGCAGGAGTCAATGGAC

CACCTCCTTTGTACCATCTAGAAAGGAAGAAGTCTTCCCTCCCAGCTGCCACAGCTGCTGTGACAAAGGGAACCCGCTTCGTGGGACACGGTTACTGCAG

GTTTCCCAGAACAGCTCACGCAGATTTTATAG GAATCAAGGCCAGCTTCCGGACAAGGGTGCCTGAAGGGCTGATCCTCCTGGCACTGTCCCCTGGCGA

CCAGGAAGAGTATTTCACCCTGCAGTTGAAGAATGGCCGTCCTTACTTTCTTTACAATTCCCAG GGAACACTAGTGGAAGTTACCCCAACTGATGATCC

TAGTCAAGGATACAGGGATGGAGAGTGGCATGAAATCATAGCAGTCAGACATCAGGCTTTTGGCCAGATTACTCTTGATGGACAGTACACAG GCTCCTC

TTCTTCTCTGAATGGAAGCTCCGTGACAGGAGGCTACACTGGACTGTTTGTGGGTGGAGTGCCACAAGGTCATAGCGTCCTCCAGAAGAGGCTTG AGAT

AATCCAAAGAGGTTTTGTGGGCTGCCTCAAGGATGTGTTCATCATGAAGGGTTACAGCCCCTCTGGGACGTGGCTACCTTTGGATTGGCAGAGCTCTGAG

GAGCAGGTGAATGTTCATCCCAGCTGGGAAGGTTGTCCCACCAACCTAGAAGAAGGAGTTCAGTTCCTAGGAGCAG GATTTCTGGAGCTTCCTTCAGAT

ACGTTTCATGCTGCAAAGGACTTTGAGATCTCCCTGAAGTTTCAAACAGACCAACTAAATGGATTGCTTCTTTTCATTCACAATACAGAGGGACCGGATT

TTCTTGCG GTGGAGCTGAAGAGAGGGCTGCTGAGCTTCAAGTTCAATTCCAGTCTCGTCTTTACACGCGTGGATCTCAGGCTGGGGCTGGCCGATTGTG

ATGGAAAGTGGAATACAGTCAGTATCAAAAAGGAAGGCTCTGTGGTATCTGTCCGTGTGAATGCACTTAAGAAGAGCACCTCCCAGGCTGGAGGCCAGCC

TCTGCTGGTGAATTCTCCTGTCTATCTGGGCGGGATCCCACGGGAGCTGCAGGACGCCTACAGACATTTGACTCTGGAGCCAG GGTTCCGTGGTTGCGT

GAAGGAAGTTGCATTTGCACGGGGTGTTGTCGTTAACTTGGCATCTGTGTCCAGCCGTGCTGTCAGAGTCAATCAGGATGGATGCCTATCAAGTGACAGT

ACTGTTAACTGTGGGGGAAATGACTCCATCCTGGTTTATCGGGGAAGCCAGCAGAGTGTTTATGAGAGCGGTCTCCAGCCCTTTACAG AATACCTGTAT

CGGGTCACAGCCTCACACGAAGGAGGAGCGGTGTCCAGTGATTGGAGTCGGGGACGCACATTGGGCACAG CTCCGCAGAGTGTGCCAACTCCCTCAAGA

GCCCAGAGCATAAACGGATCCAGCGTTGAGGTGGCCTGGAATGAGCCTGCTGTGGTTAAAGGTGTCCTGGAGAAGTACGTTCTGAAAGCCTACAGTGAGG

ACAGCTCCCAGCCCCGCGTGCCCTCTGCCAGCACTGAGCTTCATGACACCAGCACCCACTCAG GCGTGTTGATAGGACTTCATCCCTTCCACAGCTACA

CGGTAACCCTGACTGCTTGTTCTCGGGCAGGCTGCACCGAGAGCTCACAGGCATTGAGCATCTCCACTCCACAAGAAG CGCCCCAGGAGGTGCAGGCAC

CAGTCGCCGTGGCCCTTCCCAACTCCTTGTCATTCTTTTGGAGTCTACCCAGACAAGCAAATGGGATTATTACGCAGTACTCCTTATACGTGGATGGGAG

GCTGGTCTACACAGGCAAGGGACAGAACTACACAGTCACAG ATTTAAGAGTATTCGCAGCCTACGAGATTATAGTTGGTGCATGCACACAAGCAGGGTG

CACAAACAGCTCCCAAGTCATCTTGCACACAGCACAGCTGCCGCCAGAGCAAGTGGATCCCCCGGGTTTGACTGTCCTGGATTCTAGGACTATCCATGTA

CG GTGGAAACAACCAAGGCAACTAAATGGAATTCTGGAGCGCTACATATTATATATTTTGAATCCTATACATAACTCCACAATGTGGAGTGTTGTCTAT

AACAGCACAGAAAAACTCCAGGCTCACGTGCTCCACCACCTTTCCCCTGGGGGTCTATACCTCATCAGGCTGAGA - UNI35741 - GTGTGTACCGG

TGGGGGCTGCACAACAAGTGAGCCCAGCCAGGCCCTAATGGAGGAGACGATTCCAGAAGGTGTGCCAGCCCCCAGAGCTCACTCCTACTCACCAGACTCC

TTTAACATCTCCTGGACAGAGCCTGAGTATCCGAATG GAGTGATCACCACATATGAGTTATATCTAGATGACACTCTGATTCACAATTCATCAGGACTC

AGCTGCCATGCCTATGGATTTGATCCTGGGAGCTTACACACCTTCCAAGTTCAAGCATGCACGGCAAAGGGTTGTGCTCTGGGCCCACTG GTAGGAAAC

CGGACTCTAGAAGCTCCTCCGGAAGGCGTGGTCAACGTGCTTGTCAAACCTGAGGGATCCCGGGAAGCCCACGTGAGGTGGGATGCGCCTGCGCACCCTA

ACGGGCGCTTAACCTACTCAGTCCATTTCACCGGAAGTTTCTATGCAGATCAAG CAGGTGACAACTACACCCTTCTCAGTGGTACAAAAACTATCCGCG

GCATCGAAGGAAGCCGGCTCTGGGTGCTGGTGGACGGACTGGTTCCTTGCTCACACTACATGGTACAAGTGAATGCTTCTAACAGCAGAGGGAGCGTGCT

CAGTGACCCTGTTTCCGTTGAAATGCCTCCCGGGG CTCCAGATGGCCTGCTGTCTCCCAGGCTTGCAGCTGCCGCTCCAACCAGTCTTCAGGTTGTCTG

GTCTACACCAGCTCGCAACAACGCTCCGGGCTCTCCCAGATACCAGCTCCAGATGAGGCCTGGTCCCTCCACTCATGGCCGTCTAGA ATTATTCCCCAT

TCCTTCTGCATCGTTAAGCTACGAAGTGACTGGTCTCCAGCCGTTCACAGTGTATGAGTTTCGGTTGGTTGCCACCAATGGCTTTGGCACTGCATACAGT

GCTTGGACTCCGCTCATGACTACAGAGGACA AGCCTGGACCTATAGATGCTCCAATTCTTATCAATGTGAAAGCTAGGATGTTGTCGGTCATCTGGAGG

CAGCCTGCAAAGTGCAATGGGGCCATTACCCATTATAACATCTACCTGCATGGCCGTCTCTACTTAACAGTCTCTGGACGAGTCACTAACTATACTGTGG

TCCCTCTGCATCCTTACAAGGCCTATCACTTCCAGGTAGAAGCCTGCACCTCCCAAGGGTGCTCTAAGTCACCATCGTCTGAGACTGTGTGGACACTCCC

AGGAAATCCAGAAGGCATCCCAAGCCCACAGTTGTTCCCATACACTCCAACATCAATCATAGTAACTTGGCAACCCTCGGCACACCTGGATCTCTTGGTT

GAGAACGTTACAATCGAGAGACGAGTCAAAGGGAAAAAGGAAGTTAGGAACCTGGTGACCCTGGCAAGAAGTCAAGCCATGAAGTTTATTGATAATGATC

CTGCCCTCCGCCCTTGGACACGCTATGAATACCGGGTTCTGGGGAGCACTCTTGATGGGGGCACAAACAGCAGTGCTTGGGTAGAAGTGACCACAAGACC

CTGTCGGCCTTCCGGAGTACAGCCACCCACAGTGCGTGTGCTGGCACCAGATACAGTCGAG GTCTCTTGGAAAGCCCCACTTATGCAGAACGGAGATAT

ACTGAGCTATGAGATACGAATGCCAGAGCCTCTCATCAAAATGACCAATATGAGCTCCATCATGTTGAGTCATCTGGTCAAGCATCTGATCCCTTTCACA

AACTATTCAGTCACCATCGTTGCTTGCTCTGGAGGTAACGGGTACCTAGCAGGGTGCACGGAGAGCCCACCCACCCTTGCTACTACTCACCCAGCCCCGC

CTCAGGAACTGGCCCCGTTGTCTGTGATTCTTCTAAGTGAATCTGATGTTGGGATTTCTTGGCAGCCACCATCCAAACCAAATGGACCAAATTTGAG AT

ACGAGCTTCTGAGATGTAAAATCCAGCAGCCACTTGCTTCAAATCCCCCAGAAGATTTAAATCTGTGGCACAATATTTACTCAGGAACTCGGTGGTTTTA

CAAAGATAAGGGTCTTAGCAG GTTCACAACGTACGAATATAAGCTCTTTGTACACAACAGTGTGGGCTTTACACCAAGCCGAGAAGTGACAGTCACCAC

CTTAGCAGGCTCTCCAGAGAGAGGAGCCACGGTCACCGCAAGCATCCTTAATCACACAGCCATAGACGTGAGATGGAAGAAACCAA CATTTCAAGATCT

ACAAGGTGATGTGGAATATTACACACTGTTTTGGAGTTCTGGGACCTCAGAGGAATCTCTGAAAATCTTCCCGGATGTAGACTTTCACGTCATTGGCCAG

TTATCTCCAAACGTGGAGTACCAGGTTTTCCTCTTGGTTTTCAATGGAGTCCACGCAATCAACAGCACAGTTGTGCATGTGACCATGTGGGAGGAGG AG

CCTCAGGGCATGCTTCCCCCAGAGGTTGTCATCATCAACAGTACAGCTGTACGTGTCATCTGGACATCGCCTTCAAACCCAAATGCCGTTGTCACCGAGT

CTTCTGTCTATGTAAATAATAAGCTCTACAAGACTGGAACGGATGCGCCCGGGTCGTTTGTTCTGGAAGACCTGTCTCCCTTCACTATCTATGACATTCA

G GTGGAAGTCTGTACAAAAGACGCCTGCGTGAAAAGCAATGGAACGCAAGTCAGCACAGCGGAAGATACTCCAAGTGACATTTCAATACCTGTAATCCG

AGGTATTACTTCAAG ATCCCTTCAAATAGATTGGACAACACCAGCAAATCCAAATGGTATCATTCTTGGGTATGACGTTTTGCGGAAAACATGGCGCCC

ATGCTCTGAAACCCAGAAGTTAACAGACAAACCGCGTGATGAGCTTTGCAAAGCAGTCAAGTGCCAATACCCTGGAAAAGTCTGTGGGCACACGTGCTAC

TCTCCAGGAACTAAG GTATGTTGTGACGGACTTCTGTATGACCCTCAGCCTGGATACAGCTGCTGTGAGGACAAATACATCGCACTCTCTCCGAATGCC

ACTGGGGTTTGCTGTGGAGGGCGAATGTGGGAGGCACAGCCAGACCACCAGTGCTGCTCTGGGCATTACGCTAGAATCCTTCCAG GAGAGATATGCTGC

CCCGATGAGAGGCACAACCGGGTGTCCGTGGGCTTTGGTGATGCCTGCTGCGGCACAATGCCTTATGCCACCTCTGGGAGCCAGGTGTGCTGTGCCGGGA

GGCTCCAGGACGGCTATAGACAGCAGTGCTGTGGGGGAGAGATGGTGAGCCAAGATTTCCAGTGCTGTGGTGGAGGAGAAGAGGGCATGGTATACAGTTA

CCTCCCAG GAATGCTGTGTTGTGGGCAGGATTATGTGAATATGTCAGAGACCATATGCTGTTCAGCTTCCAGTGGAGAGTCTAAAGCACATGTTAGAAA

GGATGACCCCACACCAGTGAAATGCTGCGGCACTGAACTGAGTCCAGAGAGCCAGCGATGCTGTGATGGGGTTGGATATAATCCTTTGAAATATGTTTGT

TCTGATGAGATTTCAGCTGGAATGGCGATGAAG GAAACCAGAGTATGTGCGACTATCTGCCCAGCAACCATGAAAGCCACAGCACACTGTGGGAGGTGT

GACTTCAACGCCACCACCCATATCTGCACGGTGATGAGAGGGCCTCTCAATCCCACAGGGAAGAAAGCGGTGGAAGGACTGTGTTCTGCAGCAGAGGAAA

TAGTTCATTCTGGAGATGTAAACACACACTCTTTCATAG ATAGAGACCTCAAGCCAAGCACTGTGTATGAATATAGAATTTCTGCATGGAACAGCTACG

GGCGAGGATTCAGCCAATCCGTGAGAGCTAGCACAAGAGAAGATGTGCCTGAAGGAGTCAAGGCCCCTAGATGGGCCAGGACGGGCAAACATGAAGATGT

TATTTTCTTACAGTGGGAAGAGCCCATGCAGTCAAATG GTCCTATCATTCACTATATTCTTTTTCGAGACGGAAGGGAGCGCTTTCAGGGAACAGCGCT

GAGCTTCACGGACACGCAGGGAATTCAGCCACTCCAGGAATACTCATACCAGCTGAAGGCTTGCACAGCTGCTGGTTGTGCTGTCAGTTGCAAG GTAGT

CGCTGCCACCACCCAAAGAAGCCCGGAGAATGTCCCACCACCAAACATCACAGCCCAGAGCTCAGAGACTCTACACCTCAGCTGGAGTGTCCCCGAGAAA

ATGAAAGATGCCATTAAAGCATACCAGCTCTGGCTGGATGGGAAAGGGCTCATCTACACCGACACAAGTGACAGGAGGCAGCATACGGTTACAG GTCTC

CAGCCATACACAAACTACAGCTTCACACTCGCGGTTTGTACATCTGTCGGATGCACTTCCAGTGAGCCCTGTGTAGGTCAGACTCTGCAGGCTGCCCCTC

AAG GAGTTTGGGTGACACCGCGACACATTATCATCAATTCTACAACCGTGGAGCTATATTGGAATCCTCCAGAAAGGCCCAACGGCCTCATTTCTCAAT

ATCAGCTGAGGCGTAATGGAAGCTTGCTTCTCGTGGGGGGCAGAGATAATCAGAGTTTCACTGATAGCAACCTGGAGCCCGGCAGCAG GTACATTTACA

AGTTGGAAGCGAGAACTGGAGGTGGTAGCAGTTGGAGTGAGGACTACCTTGTCCAGATGCCTCTGTGGACCCCAGAAGACATTCATCCCCCATGTAATGT

CACTGTGCTGGGCTCTGATTCCATATTTGTAGCATGGCCAACACCAG GGAACCTGCTTCCCAAAATTCCAGTCGAGTACAGCATCTTACTCAGTGGCGG

GAGTGTGACGCTCTTAGTCTTCTCTGTCAGACACCGGCAATCTGCACACCTGAAAAACCTGTCTCCGTTCACACAGTATGAAATACGGATCCAAGCCTGC

CAAAATG GGGGCTGTGGAGTCAGCCCTGGGACATACGTCAGAACGCTTGAAGCAGCACCCGTGGGTCTGATGCCCCCTCTTCTGAAGGCTCTGGGGTCA

TCTTGCATAGAGGTTAAGTGGATGCCACCAACGAGACCCAATGGAATCATCACTAGCTATGTCGTTCACAG GCGTCCTGCTGACACTGAAGAAGAGTCT

CTGCTCTTTGTCTGGTCAGAAGGAGCTCTGGAGTTTACTGATGATACAGGCACTCTGCGGCCTTTTACACTGTATGAGTACCGGGTGAGAGCCTGGAACT

CCCAGGGTGCAGTGGACAGCCCGTGGTCCACAATACAGACCCTGGAAGCCCCACCTCGAGGCCTCCCAGCACCACGGGTTCAAGCCACCAGTGCTCATTC

AGCCATGCTAAACTGGACAGAGCCAGAGGCCCCCAATGGCCTCATCTCCCAGTACCATGTGATCTACCAAGAAAGACCAGATGCGGCAGCACCCGGCAGT

TCTACCGTGCATGCTTTCACGGTGACG GGAACGAGTCGTCAAGCCCATCTCTTTGGCTTGGAACCATTCACAACATACCACATTGGTGTGGTGGCTGTA

AACAGTGCAGGAAAGGTGTCGAGCCCCTGGACCCTGATTAAGACTTTAGAATCTGCCCCAAGCGGACTGATGAACTTCACAGTGGAGCAGAGAGAAAAGG

GCCGGGCTTTGCTGCTGCAGTGGTCAGAGCCAGTGAAGACCAATGGAGTGATCAAG GCATACAACATCTTCAATGATGGGGTCCTGGAGTACTCTGGCC

TGGGTCGGCAGTTTCTCTTCAGGCGCCTGGCCCCCTTCACTCTCTATACCTTGATCCTGGAGGCCTGCACGACAGCAGGCTGTGCTCACTCGGTGCCTCA

GCCTCTCTGGACAGAGGAAGCCCCTCCAGATACTCAGATGGCTCCTACCATCCAGTCTGTGGGGCCCACCAATGTAAGGCTGCACTGGTCTCAGCCGGCT

AGCCCCAATGGGAAGATAATCCATTACGAAGTGATCCGCAGACGCTCGGAGGAAGAGGACTGGGGGAACACAACATGGCAGGCAGACGGGAACACTGTTT

TCACAGAATACAACACGCAAGGGAATGCATGGGTGTATAATGACACGGGTCTGCAGCCGTGGAGGCAGTATGCTTATAGAATCTGCGCTTGGAATTCTGC

AGGGCACACCTGTAGCTCTTGGAATGTGGTGAGAACATTGCAAGCACCCCCAGATGGCCTCTCTCCACCAGAGATATCCTATGTGTCTATGAGTCCCCTC

CAACTGCTGATTTCCTGGCTTCCACCCCGACACTCTAACGGTGTCATCCAGGGCTACAGACTTCAAAGAGATGGAGTGCTTCCTGCTCTCAATTTCAATG

CCAGCACCTTCAGCTACATGGACAGCCAGCTGCTTCCCTTCTCAACGTACAGTTATGCCATCCTGGCCTGCACAGGTGGTGGCTGCTGTACCAGTGAACC

CACCAACATCACCACTCCTGAGGTACCTCCATCAGAAGTCAGCCCTCCAGTTCTTTGGGACATCAGTGCCCACCAGATGAATGTGTCTTGGTCCCCGCCA

TCAATCCCAAATGGAAAGATTGTTAAATATTTGCTTCAATGCGATGGTGAGGAGCACCTGGCTGGGCAGGGTCTGTCCTTTCTGCTCTCTAACCTGCAGC

CTTCCACTCAGTATAATATCTCCCTTGTGGCCTGCACAAGTGGAGGGTGCACTGCTAGTAGGACCACATCCGCCTGGACAAAGGAGGCTCCACCAGAGAA

CATGGACCCACCAACACTGCACATCACAGGCCCAGAATCAATAGAAATTACATGGACACCTCCAAGAAACCCACATGGCCTGATCAGAAGTTATGAGCTT

CGGAGAGATGGAGCCATTGTGTATGTAGGTCTGGAAACTCGCTACCATGATTTTACCCTTGCTCCTGGTGTTGAATACAGCTACTCGGTGACTGCCACTA

ACAGCCGGGGCAGTGTCTTGAGCCCACTTGTCAAGGGTCAAACTAGCCCCTCAGCCCCCTCAGGTTTACAGCCCCCAAAGCTGCATTCGGGGGATGCTCT

TGAGCTCTTAGCTGATTGGGACCCTCCGGTGAGGACAAACGGCAAGATCATCAACTACACTCTCTTCGTCCGTGAGATGTTTGAAGGAAAAACCAGAGCC

ATGTCCATTAACACAACACACAGTTCTTTTGGCACACGGTCACTCACGGTAAAGCACCTGAAGCCGTTTCATAG GTATGAAGTGCGTGTCCAAGCCTGC

ACTGCCCTCGGGTGTACCTCCAGTGAGTGGACATCTACCCAAACCTCAGAGGTCCCACCACTGAGGCAGCCAGCCCCACATCTGGAGGTGCAGACAGCTA

CAGGGGGATTCCAGCCCATAGTAGCCGTGTGGTGGGCAGGACCACTTCAGCCAAATGGAAAAATCATATGCTTTGAATTGTACAGAAGACAAGTAGCAGC

CTGGCCTGGCACATCCAGTTCACTGCTAATCTACAACGGCAGCTTCCGCTCCTTTATGGACTCAGAGCTACTACCATTCACGGAATACGAATACCAG GT

ATGGGCGGTGAATTCTGCAGGCAAAGCTGCAAGTAACTGGACACGGTGCAGAACTGGACCTGCCCCACCGGAAGGTCTCCAAGCGCCCACATTCCACACC

GTCTCCTCCACCCGAGCGGTGGTCAACATCAGTGTGCCTTCGAGACCCAATGGGAACATCAGCCTCTTCAGGGTCTTCTCCAACTCCAGCGGGACGCACG

TCACG CTGTCTGAAGGCACCGCCACCCAGCAGACCCTTCATGACCTGAGTCCCTTCACCACATACACCATTGGGGTTGAGGCCTGCACCTGCTTCAACT

GCTGCAGCCGAGGCCCGACAGCCGAGCTGAGGACCCACCCTGCCCCGCCCTCAGGGCTGTCTCCTCCCCAGGTCCAGACACTGGGCTCCAGGATGGCCTC

CGTCCACTGGACTCCCCCCCTGCTCCCCAATGGTGTCATTCACAG CTATGAGCTGCAGCTGCAGCGGGCTTGCCCTCCTGATTCAGCCCCACGCTGCCC

TCCAAGCCACACAGAAAGGAAGTACTGGGGCCCTGGGCACAGAGCCAGCCTGGCGGGGCTTCAGCCTAATACTGCCTACGGGGTGCAAGTGGTGGCATAC

AATGAAGCAGGCAGCACGGCTTCCGGGTGGACCAACTTCAGCACCAAGAAGGAGA TGCCTCAGTACCAAGCCCTGTTCTCAGTGGACAGCAACGCATCC

ATGGTGTGGGTGGACTGGAGTGGCACTTTTCTCCTGAACGGCCATCTAAAGGAGTACGTGGTCACCGACGGAGGACGGAGGGTGTACAGTGGCCTAGACA

CCACACTCTACATACCAAGGATGGTGGACAAAA TTTTCTTCTTCCAGGTCACCTGCACGACCGACATTGGAAGTGTTAAGACTCCACTGGTCCAATATG

ATGCTGCTACTGGATCTG GCCTGGTGCTGACAACTCCTGGAGAAAAGAAGGGAGCAGGGACCAAAAGCACAGAGTTCTACAGTGAGCTGTGGTTTATTA

TGGTAATGGCTGTGGTGGGCCTGATCTTGTTGGCCATTTTTCTGTCCTTGATTCTACAAAGAAAAATCCACAAGGAACCATGTATCAGAGAGCGACCTCC

CTTGGTACCTCTTCAGAAACGAATGACCCCACTGAGCGTCTACCCACCAGGGGAAACCCATGTG TTTGATTCTGTGGCTGATATATCTGACGTGTCCAG

CAATGTCACCCTAAAAAGTTACACCATGCATTTTGAG GGATTAGCCGACACCAGACTCCCTAGGTCTGGGACACCTATGAGTATTCGGAGCAGCCAAAG

TGTGTCTGTACTGCGGATCCCAAGTCAAAGCCAACTGAGCCACGCCTACTCCCAGAGCTCTCTCCACCGCAGTGTCAGCCAGCTCATGGACATGGCAGAC

AAGAAGGTTGTTACGGAAGACTCACTGTGGGAAACTATTATGGGCCACAGCAGTGGACTG TATGTGGACGAAGAAGAGCTCATGAACGCCATCAAGGGT

TTCAGCTCCGTGACCAAGGAGCACACCGCCTTTACCGACACCCACCTCTGA
Translation
MHYLALSPGFLCYTIKTLILAYLASVLVLAASQGVFPRLENVGAFRKVSTVPTHATCGFPGPSTFCRSPVAAEHVQLCTERLCIQDCPYRSASPLYTALL

EGLRSCIPADDGDLHPYSRSSSVSFMFGSHQNCPSLRAPRLAAELTLAVWLKLEQGGTM MCVIEKTVDGQIVFKVTISEKETMFYYRTVNGLQPPIKVM

TPGRILMKKWIHLTVQ VHQTAISFFVDGLEENSTAFDTRTLHDSVTDSVSSVIQVGQSLNG - UNI31635 - GSEQFVGRMQDFRLYNVSLTNR R

EILEVFSGDFPHLHIQPHCRCPGSHPRVHPSVQQYCIPNGAGDTPEHRMSRLNPEAHPLSFINDDDVATSWISHVFTNITQLYEGVAISIDLENGQYQ V

LKVITQFSSLQPVAIRIQRKKADSSPWEDWQYFARNCSVWGMKDNEDLENPNSVNCLQLPD DFIPFSHGNVTFDLLTSGQKHRPGYNDFYNSSVLQEFM

RATQIRLHFHGQYYPAGHTVDWRHQYYAVDEIIVSGR RCQCHGHAETCDRTRRPYRCLCSPHSFTEGPQ CDRCSPLYNDKPFRSGDNVNAFNCKPCQC

HGHASSCHYDASVDPFPLEHNRGGGGVCDDCQHHTTG GRHCESCQDYFYRPVGADPAAPDACKLCDCNRAGTRNGSLHCDP IGGQCDCKRRVSGRQCL

QCQDGFYDLQALDPDGCRPCNCNPSGTVDGDITCHQNSGQCSCKANVIG GLRCNRCNFGFKFLQSFNGDGCEPCQCNLHGSVNQLCDPLSGQCACKKEA

KGLKCDSCRENFYGLPWSACEVCDCSKAGSQPGTVCDTETGQCVCKPNVGGRQCSQCKAGYFNLYQNDSHLCLTCNCEKMGTVNGSLRCDKSTGQCPCKL

GVTGLRCHQCKPHRFNLTMDNPQGCQACDCDSLGTLPGSMCDPISGQCLCLPHRQGRRCEQCQPG GFYSSPSNATGCLPCLCHTAGAVSHICNSVTGQC

SCHDPSTTGRSCHQCQESYFRFDPLTGR RCRPCHCHVAGASNGTCDAVTGQCFCKEFVTGSKCDTCVPGASHLDVNNLLGCSKT TPSQQPPPRGWVQS

SSTINVSWSPPECPNAHWLTYTLFRNGSEIYTTEDEHPYY YTQYFLDTSLSPHTAYSYYIETSNVHSSTRSIPVIYETKPEVSEGHLNLTHIIPVGSDS

ITLTWTGLSNSSDPVAKYVLSCTPVDSTEPCVSYEGPETSATIWNLVPFTQYCFSVQGCTNESCFYSLPIIVTTAQAPPQTQGPPTVWKISPTELRIEWS

PPVDSNG GIIISYELYMRRWLSTEESLVFESHGLVSSHSALQSVNPSKNLLQQPQASTFISGLEPHTEYAFRVLAVNMAGRVSSAWASERTGESV VPV

FMAPPSVSPLSPHSLSVSWEKPAENFTRGEIIGYKISMVSEHFPLHDVPVMCSK MVHFAKSQDQSYIVRGLEPYRTYSFTVSLCDSVGCVTSALGSGQT

LAAA APAQLRPPMVTGVNSTTVHIRWLPPAGVNGPPPLYHLERKKSSLPAATAAVTKGTRFVGHGYCRFPRTAHADFIG GIKASFRTRVPEGLILLAL

SPGDQEEYFTLQLKNGRPYFLYNSQ GTLVEVTPTDDPSQGYRDGEWHEIIAVRHQAFGQITLDGQYTG GSSSSLNGSSVTGGYTGLFVGGVPQGHSVL

QKRLE EIIQRGFVGCLKDVFIMKGYSPSGTWLPLDWQSSEEQVNVHPSWEGCPTNLEEGVQFLGAG GFLELPSDTFHAAKDFEISLKFQTDQLNGLLL

FIHNTEGPDFLA VELKRGLLSFKFNSSLVFTRVDLRLGLADCDGKWNTVSIKKEGSVVSVRVNALKKSTSQAGGQPLLVNSPVYLGGIPRELQDAYRHL

TLEPG GFRGCVKEVAFARGVVVNLASVSSRAVRVNQDGCLSSDSTVNCGGNDSILVYRGSQQSVYESGLQPFTE EYLYRVTASHEGGAVSSDWSRGRT

LGTA APQSVPTPSRAQSINGSSVEVAWNEPAVVKGVLEKYVLKAYSEDSSQPRVPSASTELHDTSTHSG GVLIGLHPFHSYTVTLTACSRAGCTESSQ

ALSISTPQEA APQEVQAPVAVALPNSLSFFWSLPRQANGIITQYSLYVDGRLVYTGKGQNYTVTD DLRVFAAYEIIVGACTQAGCTNSSQVILHTAQL

PPEQVDPPGLTVLDSRTIHVR RWKQPRQLNGILERYILYILNPIHNSTMWSVVYNSTEKLQAHVLHHLSPGGLYLIRLR - UNI35741 - VCTGGG

CTTSEPSQALMEETIPEGVPAPRAHSYSPDSFNISWTEPEYPNG GVITTYELYLDDTLIHNSSGLSCHAYGFDPGSLHTFQVQACTAKGCALGPL VGN

RTLEAPPEGVVNVLVKPEGSREAHVRWDAPAHPNGRLTYSVHFTGSFYADQA AGDNYTLLSGTKTIRGIEGSRLWVLVDGLVPCSHYMVQVNASNSRGS

VLSDPVSVEMPPGA APDGLLSPRLAAAAPTSLQVVWSTPARNNAPGSPRYQLQMRPGPSTHGRLE ELFPIPSASLSYEVTGLQPFTVYEFRLVATNGF

GTAYSAWTPLMTTEDK KPGPIDAPILINVKARMLSVIWRQPAKCNGAITHYNIYLHGRLYLTVSGRVTNYTVVPLHPYKAYHFQVEACTSQGCSKSPSS

ETVWTLPGNPEGIPSPQLFPYTPTSIIVTWQPSAHLDLLVENVTIERRVKGKKEVRNLVTLARSQAMKFIDNDPALRPWTRYEYRVLGSTLDGGTNSSAW

VEVTTRPCRPSGVQPPTVRVLAPDTVE VSWKAPLMQNGDILSYEIRMPEPLIKMTNMSSIMLSHLVKHLIPFTNYSVTIVACSGGNGYLAGCTESPPTL

ATTHPAPPQELAPLSVILLSESDVGISWQPPSKPNGPNLR RYELLRCKIQQPLASNPPEDLNLWHNIYSGTRWFYKDKGLSR RFTTYEYKLFVHNSVG

FTPSREVTVTTLAGSPERGATVTASILNHTAIDVRWKKPT TFQDLQGDVEYYTLFWSSGTSEESLKIFPDVDFHVIGQLSPNVEYQVFLLVFNGVHAIN

STVVHVTMWEEE EPQGMLPPEVVIINSTAVRVIWTSPSNPNAVVTESSVYVNNKLYKTGTDAPGSFVLEDLSPFTIYDIQ VEVCTKDACVKSNGTQVS

TAEDTPSDISIPVIRGITSR RSLQIDWTTPANPNGIILGYDVLRKTWRPCSETQKLTDKPRDELCKAVKCQYPGKVCGHTCYSPGTK VCCDGLLYDPQ

PGYSCCEDKYIALSPNATGVCCGGRMWEAQPDHQCCSGHYARILPG GEICCPDERHNRVSVGFGDACCGTMPYATSGSQVCCAGRLQDGYRQQCCGGEM

VSQDFQCCGGGEEGMVYSYLPG GMLCCGQDYVNMSETICCSASSGESKAHVRKDDPTPVKCCGTELSPESQRCCDGVGYNPLKYVCSDEISAGMAMK E

TRVCATICPATMKATAHCGRCDFNATTHICTVMRGPLNPTGKKAVEGLCSAAEEIVHSGDVNTHSFID DRDLKPSTVYEYRISAWNSYGRGFSQSVRAS

TREDVPEGVKAPRWARTGKHEDVIFLQWEEPMQSNG GPIIHYILFRDGRERFQGTALSFTDTQGIQPLQEYSYQLKACTAAGCAVSCK VVAATTQRSP

ENVPPPNITAQSSETLHLSWSVPEKMKDAIKAYQLWLDGKGLIYTDTSDRRQHTVTG GLQPYTNYSFTLAVCTSVGCTSSEPCVGQTLQAAPQG GVWV

TPRHIIINSTTVELYWNPPERPNGLISQYQLRRNGSLLLVGGRDNQSFTDSNLEPGSR RYIYKLEARTGGGSSWSEDYLVQMPLWTPEDIHPPCNVTVL

GSDSIFVAWPTPG GNLLPKIPVEYSILLSGGSVTLLVFSVRHRQSAHLKNLSPFTQYEIRIQACQNG GGCGVSPGTYVRTLEAAPVGLMPPLLKALGS

SCIEVKWMPPTRPNGIITSYVVHR RRPADTEEESLLFVWSEGALEFTDDTGTLRPFTLYEYRVRAWNSQGAVDSPWSTIQTLEAPPRGLPAPRVQATSA

HSAMLNWTEPEAPNGLISQYHVIYQERPDAAAPGSSTVHAFTVT GTSRQAHLFGLEPFTTYHIGVVAVNSAGKVSSPWTLIKTLESAPSGLMNFTVEQR

EKGRALLLQWSEPVKTNGVIK AYNIFNDGVLEYSGLGRQFLFRRLAPFTLYTLILEACTTAGCAHSVPQPLWTEEAPPDTQMAPTIQSVGPTNVRLHWS

QPASPNGKIIHYEVIRRRSEEEDWGNTTWQADGNTVFTEYNTQGNAWVYNDTGLQPWRQYAYRICAWNSAGHTCSSWNVVRTLQAPPDGLSPPEISYVSM

SPLQLLISWLPPRHSNGVIQGYRLQRDGVLPALNFNASTFSYMDSQLLPFSTYSYAILACTGGGCCTSEPTNITTPEVPPSEVSPPVLWDISAHQMNVSW

SPPSIPNGKIVKYLLQCDGEEHLAGQGLSFLLSNLQPSTQYNISLVACTSGGCTASRTTSAWTKEAPPENMDPPTLHITGPESIEITWTPPRNPHGLIRS

YELRRDGAIVYVGLETRYHDFTLAPGVEYSYSVTATNSRGSVLSPLVKGQTSPSAPSGLQPPKLHSGDALELLADWDPPVRTNGKIINYTLFVREMFEGK

TRAMSINTTHSSFGTRSLTVKHLKPFHR RYEVRVQACTALGCTSSEWTSTQTSEVPPLRQPAPHLEVQTATGGFQPIVAVWWAGPLQPNGKIICFELYR

RQVAAWPGTSSSLLIYNGSFRSFMDSELLPFTEYEYQ VWAVNSAGKAASNWTRCRTGPAPPEGLQAPTFHTVSSTRAVVNISVPSRPNGNISLFRVFSN

SSGTHVT LSEGTATQQTLHDLSPFTTYTIGVEACTCFNCCSRGPTAELRTHPAPPSGLSPPQVQTLGSRMASVHWTPPLLPNGVIHS SYELQLQRACP

PDSAPRCPPSHTERKYWGPGHRASLAGLQPNTAYGVQVVAYNEAGSTASGWTNFSTKKEM MPQYQALFSVDSNASMVWVDWSGTFLLNGHLKEYVVTDG

GRRVYSGLDTTLYIPRMVDKI IFFFQVTCTTDIGSVKTPLVQYDAATGSG GLVLTTPGEKKGAGTKSTEFYSELWFIMVMAVVGLILLAIFLSLILQR

KIHKEPCIRERPPLVPLQKRMTPLSVYPPGETHV FDSVADISDVSSNVTLKSYTMHFE GLADTRLPRSGTPMSIRSSQSVSVLRIPSQSQLSHAYSQS

SLHRSVSQLMDMADKKVVTEDSLWETIMGHSSGL YVDEEELMNAIKGFSSVTKEHTAFTDTHL
Transcript ENSMUST00000060479
Sequence
ATGCATTACCTGGCTCTCTCACCGGGCTTCCTGTGTTACACCATTAAAACATTGATCCTTGCCTATTTGGCTTCGGTATTGGTGTTGGCTGCCTCACAGG

GCGTTTTCCCAAGGCTGGAGAATGTGGGTGCTTTCAGGAAGGTATCCACTGTGCCAACCCACGCCACGTGTGGATTCCCAGGCCCTAGCACTTTTTGTCG

TAGCCCGGTGGCGGCTGAGCATGTGCAACTGTGTACGGAGAGGCTGTGTATCCAGGATTGCCCCTACCGCTCTGCCTCTCCTCTCTATACTGCCCTCCTA

GAAGGCCTCCGGAGCTGCATCCCTGCAGACGACGGTGATCTCCACCCTTACTCCAGGAGCAGCTCCGTGAGCTTCATGTTCGGAAGTCACCAGAACTGCC

CGTCTCTACGGGCTCCGAGGCTGGCAGCCGAATTGACCTTAGCTGTGTGGTTGAAGCTTGAGCAAGGAGGCACTAT GTGTGTGATAGAAAAGACAGTGG

ACGGGCAGATTGTGTTCAAAGTTACAATATCTGAGAAAGAGACCATGTTTTATTATCGCACAGTAAATGGTTTGCAGCCTCCAATAAAAGTAATGACACC

AGGGAGAATTCTTATGAAGAAATGGATTCATCTCACTGTGCAG GTGCATCAGACGGCAATCAGCTTCTTTGTGGACGGTCTGGAGGAGAACAGTACTGC

ATTTGATACAAGAACTCTCCATGATTCAGTCACAGACTCAGTCTCCAGCGTGATACAAGTAGGACAGAGTTTAAATG - UNI31635 - GTTCAGAGC

AGTTTGTTGGAAGAATGCAAGATTTTCGATTGTACAATGTGTCACTTACAAACAG GGAGATTCTAGAGGTCTTTTCTGGAGATTTTCCTCACTTGCACA

TCCAGCCACATTGCCGATGTCCAGGTAGCCACCCCCGTGTCCACCCCTCCGTTCAGCAGTACTGCATTCCCAATGGTGCAGGAGACACGCCCGAGCATCG

AATGTCACGGCTGAATCCCGAAGCCCACCCTCTCTCCTTCATCAATGATGACGACGTTGCTACTTCATGGATCTCTCATGTGTTTACAAACATTACGCAG

CTCTATGAAGGAGTGGCTATTTCTATAGACTTAGAAAATGGACAGTACCAG GTGCTTAAAGTCATCACCCAGTTCTCCAGCCTACAGCCTGTGGCAATT

CGGATCCAGAGGAAGAAGGCAGACAGCTCTCCCTGGGAGGACTGGCAGTATTTTGCCAGAAATTGCAGTGTTTGGGGAATGAAGGACAATGAAGATTTGG

AAAATCCCAATTCTGTCAACTGTCTCCAGCTTCCTGA TTTTATCCCGTTTTCCCATGGTAATGTCACCTTTGACCTCCTGACATCTGGACAGAAGCATC

GTCCTGGGTACAACGACTTTTACAACAGCTCAGTGCTTCAAGAATTCATGAGAGCCACTCAAATAAGGCTGCACTTCCATGGGCAGTACTATCCGGCTGG

ACACACTGTTGACTGGAGACACCAATACTATGCAGTGGATGAGATCATTGTCAGTGGAAG ATGCCAATGCCACGGCCATGCTGAGACCTGTGACAGGAC

CAGACGGCCTTACAGATGTCTCTGCTCTCCACACAGCTTCACTGAAGGGCCTCAG TGTGATCGATGCTCCCCTCTTTATAATGACAAGCCTTTCCGCAG

TGGTGACAATGTTAATGCATTCAACTGTAAGCCTTGCCAGTGCCATGGCCATGCCAGCAGCTGCCACTACGATGCTTCTGTGGACCCATTTCCCCTGGAA

CACAACAGAGGCGGTGGAGGAGTCTGTGATGACTGTCAGCATCATACAACAG GGAGACACTGTGAGTCGTGCCAGGATTACTTTTACCGACCTGTTGGT

GCTGATCCTGCTGCCCCGGATGCTTGCAAGCTCTGTGACTGTAACAGGGCCGGGACTAGAAATGGCAGCCTCCACTGTGACCCG ATTGGAGGCCAATGT

GATTGTAAGAGACGTGTGTCTGGCAGACAGTGCCTTCAGTGCCAGGATGGATTCTATGACCTGCAGGCGCTAGATCCTGACGGCTGCCGTCCCTGTAACT

GTAATCCCTCTGGGACCGTGGATGGAGACATTACCTGTCACCAAAATTCAGGCCAGTGCTCGTGCAAAGCGAATGTTATTG GGCTTAGATGCAATCGCT

GCAATTTCGGATTTAAATTCCTCCAGAGTTTTAATGGTGATGGATGTGAGCCTTGCCAATGTAACCTCCACGGCTCAGTGAACCAACTCTGTGATCCGCT

TTCTGGGCAGTGTGCATGCAAGAAGGAAGCCAAAGGACTTAAGTGTGACTCTTGCAGAGAAAACTTTTATGGGTTGCCCTGGAGTGCTTGTGAGGTCTGT

GACTGCAGCAAGGCTGGGTCCCAGCCTGGGACTGTCTGTGACACTGAGACAGGGCAGTGCGTTTGTAAGCCCAATGTTGGAGGGAGACAATGTAGTCAGT

GTAAGGCAGGCTACTTCAACCTATATCAGAATGATTCCCACCTCTGTTTGACTTGTAACTGCGAGAAGATGGGAACGGTAAATGGCTCTCTAAGGTGTGA

CAAGTCAACCGGGCAGTGTCCTTGCAAACTAGGGGTAACTGGTCTGCGTTGCCACCAGTGCAAGCCTCACAGGTTCAATTTGACGATGGACAATCCTCAA

GGTTGTCAGGCGTGCGACTGTGACTCGTTGGGGACATTACCTGGAAGCATGTGTGACCCCATCAGTGGCCAGTGTCTATGTCTACCTCATCGACAAGGAA

GAAGGTGTGAGCAGTGTCAGCCAG GCTTTTACAGTTCTCCCAGCAATGCCACTGGCTGCCTGCCATGCTTATGCCACACAGCTGGTGCTGTGAGCCACA

TCTGTAATAGTGTCACGGGACAGTGCTCTTGCCATGACCCCTCAACCACTGGGCGTAGCTGTCACCAGTGTCAAGAAAGTTACTTTAGATTTGATCCCCT

GACTGGAAG ATGCAGGCCTTGTCACTGTCATGTAGCAGGAGCCTCGAATGGAACTTGTGATGCAGTCACAGGCCAGTGTTTCTGCAAAGAGTTTGTCAC

TGGCTCAAAATGTGACACTTGTGTTCCTGGTGCAAGCCACTTGGACGTCAACAATCTATTAGGCTGCAGCAAAA CTCCATCTCAGCAACCTCCACCCAG

AGGATGGGTTCAGAGTTCTTCTACCATCAATGTGTCCTGGAGTCCACCCGAGTGCCCAAATGCTCACTGGCTTACATACACTCTGTTCAGGAATGGCTCT

GAGATCTACACAACTGAAGATGAACACCCGTACT ATACTCAGTACTTCTTAGACACTAGTCTGTCACCACACACAGCATATTCATATTATATAGAGACC

TCCAATGTGCACAGTTCGACAAGGAGCATACCTGTCATTTATGAGACAAAGCCAGAGGTCTCAGAAGGACACTTGAACTTGACTCACATCATTCCTGTGG

GCTCGGACTCCATTACACTTACCTGGACTGGACTCTCCAACAGCTCTGATCCTGTGGCAAAATATGTTTTATCATGCACACCTGTGGACAGCACTGAGCC

CTGTGTCTCCTATGAAGGTCCAGAAACCTCAGCTACCATCTGGAATCTGGTTCCATTCACCCAGTACTGTTTTTCTGTCCAGGGCTGTACTAATGAGAGC

TGTTTCTACAGCTTGCCTATTATAGTAACCACAGCCCAAGCACCTCCTCAAACGCAGGGGCCACCTACAGTATGGAAAATCAGTCCCACAGAACTCAGAA

TAGAATGGTCTCCTCCAGTGGACTCAAATG GTATAATTATAAGCTATGAGTTATACATGAGGAGATGGCTGTCCACCGAAGAAAGCCTAGTGTTTGAGA

GCCACGGTTTGGTCAGTTCTCACTCAGCTTTACAGTCGGTCAATCCGAGTAAGAACCTGCTCCAGCAGCCCCAAGCCAGCACGTTCATCTCTGGCTTGGA

GCCACACACAGAGTATGCATTTAGGGTCTTGGCTGTGAATATGGCTGGCAGGGTGTCGTCTGCCTGGGCCTCAGAAAGAACGGGGGAATCAG TACCCGT

ATTCATGGCCCCTCCTTCAGTCTCTCCACTCTCACCACACTCCCTCAGTGTCTCCTGGGAGAAGCCAGCAGAAAACTTTACAAGAGGAGAAATTATAGGG

TACAAGATCAGCATGGTTTCTGAACATTTCCCTCTACACGATGTTCCAGTCATGTGCTCAAAG ATGGTGCATTTTGCTAAGTCCCAAGACCAGTCTTAC

ATCGTAAGGGGACTCGAGCCTTATAGGACCTACAGCTTCACAGTGTCCCTCTGCGATTCCGTGGGCTGTGTAACCAGTGCTTTGGGATCAGGACAAACCT

TAGCAGCAG CTCCTGCTCAGCTCCGGCCTCCCATGGTGACAGGAGTCAACAGTACTACAGTCCATATCAGGTGGCTTCCTCCTGCAGGAGTCAATGGAC

CACCTCCTTTGTACCATCTAGAAAGGAAGAAGTCTTCCCTCCCAGCTGCCACAGCTGCTGTGACAAAGGGAACCCGCTTCGTGGGACACGGTTACTGCAG

GTTTCCCAGAACAGCTCACGCAGATTTTATAG GAATCAAGGCCAGCTTCCGGACAAGGGTGCCTGAAGGGCTGATCCTCCTGGCACTGTCCCCTGGCGA

CCAGGAAGAGTATTTCACCCTGCAGTTGAAGAATGGCCGTCCTTACTTTCTTTACAATTCCCAG GGAACACTAGTGGAAGTTACCCCAACTGATGATCC

TAGTCAAGGATACAGGGATGGAGAGTGGCATGAAATCATAGCAGTCAGACATCAGGCTTTTGGCCAGATTACTCTTGATGGACAGTACACAG GCTCCTC

TTCTTCTCTGAATGGAAGCTCCGTGACAGGAGGCTACACTGGACTGTTTGTGGGTGGAGTGCCACAAGGTCATAGCGTCCTCCAGAAGAGGCTTG AGAT

AATCCAAAGAGGTTTTGTGGGCTGCCTCAAGGATGTGTTCATCATGAAGGGTTACAGCCCCTCTGGGACGTGGCTACCTTTGGATTGGCAGAGCTCTGAG

GAGCAGGTGAATGTTCATCCCAGCTGGGAAGGTTGTCCCACCAACCTAGAAGAAGGAGTTCAGTTCCTAGGAGCAG GATTTCTGGAGCTTCCTTCAGAT

ACGTTTCATGCTGCAAAGGACTTTGAGATCTCCCTGAAGTTTCAAACAGACCAACTAAATGGATTGCTTCTTTTCATTCACAATACAGAGGGACCGGATT

TTCTTGCG GTGGAGCTGAAGAGAGGGCTGCTGAGCTTCAAGTTCAATTCCAGTCTCGTCTTTACACGCGTGGATCTCAGGCTGGGGCTGGCCGATTGTG

ATGGAAAGTGGAATACAGTCAGTATCAAAAAGGAAGGCTCTGTGGTATCTGTCCGTGTGAATGCACTTAAGAAGAGCACCTCCCAGGCTGGAGGCCAGCC

TCTGCTGGTGAATTCTCCTGTCTATCTGGGCGGGATCCCACGGGAGCTGCAGGACGCCTACAGACATTTGACTCTGGAGCCAG GGTTCCGTGGTTGCGT

GAAGGAAGTTGCATTTGCACGGGGTGTTGTCGTTAACTTGGCATCTGTGTCCAGCCGTGCTGTCAGAGTCAATCAGGATGGATGCCTATCAAGTGACAGT

ACTGTTAACTGTGGGGGAAATGACTCCATCCTGGTTTATCGGGGAAGCCAGCAGAGTGTTTATGAGAGCGGTCTCCAGCCCTTTACAG AATACCTGTAT

CGGGTCACAGCCTCACACGAAGGAGGAGCGGTGTCCAGTGATTGGAGTCGGGGACGCACATTGGGCACAG CTCCGCAGAGTGTGCCAACTCCCTCAAGA

GCCCAGAGCATAAACGGATCCAGCGTTGAGGTGGCCTGGAATGAGCCTGCTGTGGTTAAAGGTGTCCTGGAGAAGTACGTTCTGAAAGCCTACAGTGAGG

ACAGCTCCCAGCCCCGCGTGCCCTCTGCCAGCACTGAGCTTCATGACACCAGCACCCACTCAG GCGTGTTGATAGGACTTCATCCCTTCCACAGCTACA

CGGTAACCCTGACTGCTTGTTCTCGGGCAGGCTGCACCGAGAGCTCACAGGCATTGAGCATCTCCACTCCACAAGAAG CGCCCCAGGAGGTGCAGGCAC

CAGTCGCCGTGGCCCTTCCCAACTCCTTGTCATTCTTTTGGAGTCTACCCAGACAAGCAAATGGGATTATTACGCAGTACTCCTTATACGTGGATGGGAG

GCTGGTCTACACAGGCAAGGGACAGAACTACACAGTCACAG ATTTAAGAGTATTCGCAGCCTACGAGATTATAGTTGGTGCATGCACACAAGCAGGGTG

CACAAACAGCTCCCAAGTCATCTTGCACACAGCACAGCTGCCGCCAGAGCAAGTGGATCCCCCGGGTTTGACTGTCCTGGATTCTAGGACTATCCATGTA

CG GTGGAAACAACCAAGGCAACTAAATGGAATTCTGGAGCGCTACATATTATATATTTTGAATCCTATACATAACTCCACAATGTGGAGTGTTGTCTAT

AACAGCACAGAAAAACTCCAGGCTCACGTGCTCCACCACCTTTCCCCTGGGGGTCTATACCTCATCAGGCTGAGA - UNI35741 - GTGTGTACCGG

TGGGGGCTGCACAACAAGTGAGCCCAGCCAGGCCCTAATGGAGGAGACGATTCCAGAAGGTGTGCCAGCCCCCAGAGCTCACTCCTACTCACCAGACTCC

TTTAACATCTCCTGGACAGAGCCTGAGTATCCGAATG GAGTGATCACCACATATGAGTTATATCTAGATGACACTCTGATTCACAATTCATCAGGACTC

AGCTGCCATGCCTATGGATTTGATCCTGGGAGCTTACACACCTTCCAAGTTCAAGCATGCACGGCAAAGGGTTGTGCTCTGGGCCCACTG GTAGGAAAC

CGGACTCTAGAAGCTCCTCCGGAAGGCGTGGTCAACGTGCTTGTCAAACCTGAGGGATCCCGGGAAGCCCACGTGAGGTGGGATGCGCCTGCGCACCCTA

ACGGGCGCTTAACCTACTCAGTCCATTTCACCGGAAGTTTCTATGCAGATCAAG CAGGTGACAACTACACCCTTCTCAGTGGTACAAAAACTATCCGCG

GCATCGAAGGAAGCCGGCTCTGGGTGCTGGTGGACGGACTGGTTCCTTGCTCACACTACATGGTACAAGTGAATGCTTCTAACAGCAGAGGGAGCGTGCT

CAGTGACCCTGTTTCCGTTGAAATGCCTCCCGGGG CTCCAGATGGCCTGCTGTCTCCCAGGCTTGCAGCTGCCGCTCCAACCAGTCTTCAGGTTGTCTG

GTCTACACCAGCTCGCAACAACGCTCCGGGCTCTCCCAGATACCAGCTCCAGATGAGGCCTGGTCCCTCCACTCATGGCCGTCTAGA ATTATTCCCCAT

TCCTTCTGCATCGTTAAGCTACGAAGTGACTGGTCTCCAGCCGTTCACAGTGTATGAGTTTCGGTTGGTTGCCACCAATGGCTTTGGCACTGCATACAGT

GCTTGGACTCCGCTCATGACTACAGAGGACA AGCCTGGACCTATAGATGCTCCAATTCTTATCAATGTGAAAGCTAGGATGTTGTCGGTCATCTGGAGG

CAGCCTGCAAAGTGCAATGGGGCCATTACCCATTATAACATCTACCTGCATGGCCGTCTCTACTTAACAGTCTCTGGACGAGTCACTAACTATACTGTGG

TCCCTCTGCATCCTTACAAGGCCTATCACTTCCAGGTAGAAGCCTGCACCTCCCAAGGGTGCTCTAAGTCACCATCGTCTGAGACTGTGTGGACACTCCC

AGGAAATCCAGAAGGCATCCCAAGCCCACAGTTGTTCCCATACACTCCAACATCAATCATAGTAACTTGGCAACCCTCGGCACACCTGGATCTCTTGGTT

GAGAACGTTACAATCGAGAGACGAGTCAAAGGGAAAAAGGAAGTTAGGAACCTGGTGACCCTGGCAAGAAGTCAAGCCATGAAGTTTATTGATAATGATC

CTGCCCTCCGCCCTTGGACACGCTATGAATACCGGGTTCTGGGGAGCACTCTTGATGGGGGCACAAACAGCAGTGCTTGGGTAGAAGTGACCACAAGACC

CTGTCGGCCTTCCGGAGTACAGCCACCCACAGTGCGTGTGCTGGCACCAGATACAGTCGAG GTCTCTTGGAAAGCCCCACTTATGCAGAACGGAGATAT

ACTGAGCTATGAGATACGAATGCCAGAGCCTCTCATCAAAATGACCAATATGAGCTCCATCATGTTGAGTCATCTGGTCAAGCATCTGATCCCTTTCACA

AACTATTCAGTCACCATCGTTGCTTGCTCTGGAGGTAACGGGTACCTAGCAGGGTGCACGGAGAGCCCACCCACCCTTGCTACTACTCACCCAGCCCCGC

CTCAGGAACTGGCCCCGTTGTCTGTGATTCTTCTAAGTGAATCTGATGTTGGGATTTCTTGGCAGCCACCATCCAAACCAAATGGACCAAATTTGAG AT

ACGAGCTTCTGAGATGTAAAATCCAGCAGCCACTTGCTTCAAATCCCCCAGAAGATTTAAATCTGTGGCACAATATTTACTCAGGAACTCGGTGGTTTTA

CAAAGATAAGGGTCTTAGCAG GTTCACAACGTACGAATATAAGCTCTTTGTACACAACAGTGTGGGCTTTACACCAAGCCGAGAAGTGACAGTCACCAC

CTTAGCAGGCTCTCCAGAGAGAGGAGCCACGGTCACCGCAAGCATCCTTAATCACACAGCCATAGACGTGAGATGGAAGAAACCAA CATTTCAAGATCT

ACAAGGTGATGTGGAATATTACACACTGTTTTGGAGTTCTGGGACCTCAGAGGAATCTCTGAAAATCTTCCCGGATGTAGACTTTCACGTCATTGGCCAG

TTATCTCCAAACGTGGAGTACCAGGTTTTCCTCTTGGTTTTCAATGGAGTCCACGCAATCAACAGCACAGTTGTGCATGTGACCATGTGGGAGGAGG AG

CCTCAGGGCATGCTTCCCCCAGAGGTTGTCATCATCAACAGTACAGCTGTACGTGTCATCTGGACATCGCCTTCAAACCCAAATGCCGTTGTCACCGAGT

CTTCTGTCTATGTAAATAATAAGCTCTACAAGACTGGAACGGATGCGCCCGGGTCGTTTGTTCTGGAAGACCTGTCTCCCTTCACTATCTATGACATTCA

G GTGGAAGTCTGTACAAAAGACGCCTGCGTGAAAAGCAATGGAACGCAAGTCAGCACAGCGGAAGATACTCCAAGTGACATTTCAATACCTGTAATCCG

AGGTATTACTTCAAG ATCCCTTCAAATAGATTGGACAACACCAGCAAATCCAAATGGTATCATTCTTGGGTATGACGTTTTGCGGAAAACATGGCGCCC

ATGCTCTGAAACCCAGAAGTTAACAGACAAACCGCGTGATGAGCTTTGCAAAGCAGTCAAGTGCCAATACCCTGGAAAAGTCTGTGGGCACACGTGCTAC

TCTCCAGGAACTAAG GTATGTTGTGACGGACTTCTGTATGACCCTCAGCCTGGATACAGCTGCTGTGAGGACAAATACATCGCACTCTCTCCGAATGCC

ACTGGGGTTTGCTGTGGAGGGCGAATGTGGGAGGCACAGCCAGACCACCAGTGCTGCTCTGGGCATTACGCTAGAATCCTTCCAG GAGAGATATGCTGC

CCCGATGAGAGGCACAACCGGGTGTCCGTGGGCTTTGGTGATGCCTGCTGCGGCACAATGCCTTATGCCACCTCTGGGAGCCAGGTGTGCTGTGCCGGGA

GGCTCCAGGACGGCTATAGACAGCAGTGCTGTGGGGGAGAGATGGTGAGCCAAGATTTCCAGTGCTGTGGTGGAGGAGAAGAGGGCATGGTATACAGTTA

CCTCCCAG GAATGCTGTGTTGTGGGCAGGATTATGTGAATATGTCAGAGACCATATGCTGTTCAGCTTCCAGTGGAGAGTCTAAAGCACATGTTAGAAA

GGATGACCCCACACCAGTGAAATGCTGCGGCACTGAACTGAGTCCAGAGAGCCAGCGATGCTGTGATGGGGTTGGATATAATCCTTTGAAATATGTTTGT

TCTGATGAGATTTCAGCTGGAATGGCGATGAAG GAAACCAGAGTATGTGCGACTATCTGCCCAGCAACCATGAAAGCCACAGCACACTGTGGGAGGTGT

GACTTCAACGCCACCACCCATATCTGCACGGTGATGAGAGGGCCTCTCAATCCCACAGGGAAGAAAGCGGTGGAAGGACTGTGTTCTGCAGCAGAGGAAA

TAGTTCATTCTGGAGATGTAAACACACACTCTTTCATAG ATAGAGACCTCAAGCCAAGCACTGTGTATGAATATAGAATTTCTGCATGGAACAGCTACG

GGCGAGGATTCAGCCAATCCGTGAGAGCTAGCACAAGAGAAGATGTGCCTGAAGGAGTCAAGGCCCCTAGATGGGCCAGGACGGGCAAACATGAAGATGT

TATTTTCTTACAGTGGGAAGAGCCCATGCAGTCAAATG GTCCTATCATTCACTATATTCTTTTTCGAGACGGAAGGGAGCGCTTTCAGGGAACAGCGCT

GAGCTTCACGGACACGCAGGGAATTCAGCCACTCCAGGAATACTCATACCAGCTGAAGGCTTGCACAGCTGCTGGTTGTGCTGTCAGTTGCAAG GTAGT

CGCTGCCACCACCCAAAGAAGCCCGGAGAATGTCCCACCACCAAACATCACAGCCCAGAGCTCAGAGACTCTACACCTCAGCTGGAGTGTCCCCGAGAAA

ATGAAAGATGCCATTAAAGCATACCAGCTCTGGCTGGATGGGAAAGGGCTCATCTACACCGACACAAGTGACAGGAGGCAGCATACGGTTACAG GTCTC

CAGCCATACACAAACTACAGCTTCACACTCGCGGTTTGTACATCTGTCGGATGCACTTCCAGTGAGCCCTGTGTAGGTCAGACTCTGCAGGCTGCCCCTC

AAG GAGTTTGGGTGACACCGCGACACATTATCATCAATTCTACAACCGTGGAGCTATATTGGAATCCTCCAGAAAGGCCCAACGGCCTCATTTCTCAAT

ATCAGCTGAGGCGTAATGGAAGCTTGCTTCTCGTGGGGGGCAGAGATAATCAGAGTTTCACTGATAGCAACCTGGAGCCCGGCAGCAG GTACATTTACA

AGTTGGAAGCGAGAACTGGAGGTGGTAGCAGTTGGAGTGAGGACTACCTTGTCCAGATGCCTCTGTGGACCCCAGAAGACATTCATCCCCCATGTAATGT

CACTGTGCTGGGCTCTGATTCCATATTTGTAGCATGGCCAACACCAG GGAACCTGCTTCCCAAAATTCCAGTCGAGTACAGCATCTTACTCAGTGGCGG

GAGTGTGACGCTCTTAGTCTTCTCTGTCAGACACCGGCAATCTGCACACCTGAAAAACCTGTCTCCGTTCACACAGTATGAAATACGGATCCAAGCCTGC

CAAAATG GGGGCTGTGGAGTCAGCCCTGGGACATACGTCAGAACGCTTGAAGCAGCACCCGTGGGTCTGATGCCCCCTCTTCTGAAGGCTCTGGGGTCA

TCTTGCATAGAGGTTAAGTGGATGCCACCAACGAGACCCAATGGAATCATCACTAGCTATGTCGTTCACAG GCGTCCTGCTGACACTGAAGAAGAGTCT

CTGCTCTTTGTCTGGTCAGAAGGAGCTCTGGAGTTTACTGATGATACAGGCACTCTGCGGCCTTTTACACTGTATGAGTACCGGGTGAGAGCCTGGAACT

CCCAGGGTGCAGTGGACAGCCCGTGGTCCACAATACAGACCCTGGAAGCCCCACCTCGAGGCCTCCCAGCACCACGGGTTCAAGCCACCAGTGCTCATTC

AGCCATGCTAAACTGGACAGAGCCAGAGGCCCCCAATGGCCTCATCTCCCAGTACCATGTGATCTACCAAGAAAGACCAGATGCGGCAGCACCCGGCAGT

TCTACCGTGCATGCTTTCACGGTGACG GGAACGAGTCGTCAAGCCCATCTCTTTGGCTTGGAACCATTCACAACATACCACATTGGTGTGGTGGCTGTA

AACAGTGCAGGAAAGGTGTCGAGCCCCTGGACCCTGATTAAGACTTTAGAATCTGCCCCAAGCGGACTGATGAACTTCACAGTGGAGCAGAGAGAAAAGG

GCCGGGCTTTGCTGCTGCAGTGGTCAGAGCCAGTGAAGACCAATGGAGTGATCAAG GCATACAACATCTTCAATGATGGGGTCCTGGAGTACTCTGGCC

TGGGTCGGCAGTTTCTCTTCAGGCGCCTGGCCCCCTTCACTCTCTATACCTTGATCCTGGAGGCCTGCACGACAGCAGGCTGTGCTCACTCGGTGCCTCA

GCCTCTCTGGACAGAGGAAGCCCCTCCAGATACTCAGATGGCTCCTACCATCCAGTCTGTGGGGCCCACCAATGTAAGGCTGCACTGGTCTCAGCCGGCT

AGCCCCAATGGGAAGATAATCCATTACGAAGTGATCCGCAGACGCTCGGAGGAAGAGGACTGGGGGAACACAACATGGCAGGCAGACGGGAACACTGTTT

TCACAGAATACAACACGCAAGGGAATGCATGGGTGTATAATGACACGGGTCTGCAGCCGTGGAGGCAGTATGCTTATAGAATCTGCGCTTGGAATTCTGC

AGGGCACACCTGTAGCTCTTGGAATGTGGTGAGAACATTGCAAGCACCCCCAGATGGCCTCTCTCCACCAGAGATATCCTATGTGTCTATGAGTCCCCTC

CAACTGCTGATTTCCTGGCTTCCACCCCGACACTCTAACGGTGTCATCCAGGGCTACAGACTTCAAAGAGATGGAGTGCTTCCTGCTCTCAATTTCAATG

CCAGCACCTTCAGCTACATGGACAGCCAGCTGCTTCCCTTCTCAACGTACAGTTATGCCATCCTGGCCTGCACAGGTGGTGGCTGCTGTACCAGTGAACC

CACCAACATCACCACTCCTGAGGTACCTCCATCAGAAGTCAGCCCTCCAGTTCTTTGGGACATCAGTGCCCACCAGATGAATGTGTCTTGGTCCCCGCCA

TCAATCCCAAATGGAAAGATTGTTAAATATTTGCTTCAATGCGATGGTGAGGAGCACCTGGCTGGGCAGGGTCTGTCCTTTCTGCTCTCTAACCTGCAGC

CTTCCACTCAGTATAATATCTCCCTTGTGGCCTGCACAAGTGGAGGGTGCACTGCTAGTAGGACCACATCCGCCTGGACAAAGGAGGCTCCACCAGAGAA

CATGGACCCACCAACACTGCACATCACAGGCCCAGAATCAATAGAAATTACATGGACACCTCCAAGAAACCCACATGGCCTGATCAGAAGTTATGAGCTT

CGGAGAGATGGAGCCATTGTGTATGTAGGTCTGGAAACTCGCTACCATGATTTTACCCTTGCTCCTGGTGTTGAATACAGCTACTCGGTGACTGCCACTA

ACAGCCGGGGCAGTGTCTTGAGCCCACTTGTCAAGGGTCAAACTAGCCCCTCAGCCCCCTCAGGTTTACAGCCCCCAAAGCTGCATTCGGGGGATGCTCT

TGAGCTCTTAGCTGATTGGGACCCTCCGGTGAGGACAAACGGCAAGATCATCAACTACACTCTCTTCGTCCGTGAGATGTTTGAAGGAAAAACCAGAGCC

ATGTCCATTAACACAACACACAGTTCTTTTGGCACACGGTCACTCACGGTAAAGCACCTGAAGCCGTTTCATAG GTATGAAGTGCGTGTCCAAGCCTGC

ACTGCCCTCGGGTGTACCTCCAGTGAGTGGACATCTACCCAAACCTCAGAGGTCCCACCACTGAGGCAGCCAGCCCCACATCTGGAGGTGCAGACAGCTA

CAGGGGGATTCCAGCCCATAGTAGCCGTGTGGTGGGCAGGACCACTTCAGCCAAATGGAAAAATCATATGCTTTGAATTGTACAGAAGACAAGTAGCAGC

CTGGCCTGGCACATCCAGTTCACTGCTAATCTACAACGGCAGCTTCCGCTCCTTTATGGACTCAGAGCTACTACCATTCACGGAATACGAATACCAG GT

ATGGGCGGTGAATTCTGCAGGCAAAGCTGCAAGTAACTGGACACGGTGCAGAACTGGACCTGCCCCACCGGAAGGTCTCCAAGCGCCCACATTCCACACC

GTCTCCTCCACCCGAGCGGTGGTCAACATCAGTGTGCCTTCGAGACCCAATGGGAACATCAGCCTCTTCAGGGTCTTCTCCAACTCCAGCGGGACGCACG

TCACG CTGTCTGAAGGCACCGCCACCCAGCAGACCCTTCATGACCTGAGTCCCTTCACCACATACACCATTGGGGTTGAGGCCTGCACCTGCTTCAACT

GCTGCAGCCGAGGCCCGACAGCCGAGCTGAGGACCCACCCTGCCCCGCCCTCAGGGCTGTCTCCTCCCCAGGTCCAGACACTGGGCTCCAGGATGGCCTC

CGTCCACTGGACTCCCCCCCTGCTCCCCAATGGTGTCATTCACAG CTATGAGCTGCAGCTGCAGCGGGCTTGCCCTCCTGATTCAGCCCCACGCTGCCC

TCCAAGCCACACAGAAAGGAAGTACTGGGGCCCTGGGCACAGAGCCAGCCTGGCGGGGCTTCAGCCTAATACTGCCTACGGGGTGCAAGTGGTGGCATAC

AATGAAGCAGGCAGCACGGCTTCCGGGTGGACCAACTTCAGCACCAAGAAGGAGA TGCCTCAGTACCAAGCCCTGTTCTCAGTGGACAGCAACGCATCC

ATGGTGTGGGTGGACTGGAGTGGCACTTTTCTCCTGAACGGCCATCTAAAGGAGTACGTGGTCACCGACGGAGGACGGAGGGTGTACAGTGGCCTAGACA

CCACACTCTACATACCAAGGATGGTGGACAAAA TTTTCTTCTTCCAGGTCACCTGCACGACCGACATTGGAAGTGTTAAGACTCCACTGGTCCAATATG

ATGCTGCTACTGGATCTG GCCTGGTGCTGACAACTCCTGGAGAAAAGAAGGGAGCAGGGACCAAAAGCACAGAGTTCTACAGTGAGCTGTGGTTTATTA

TGGTAATGGCTGTGGTGGGCCTGATCTTGTTGGCCATTTTTCTGTCCTTGATTCTACAAAGAAAAATCCACAAGGAACCATGTATCAGAGAGCGACCTCC

CTTGGTACCTCTTCAGAAACGAATGACCCCACTGAGCGTCTACCCACCAGGGGAAACCCATGTG GGATTAGCCGACACCAGACTCCCTAGGTCTGGGAC

ACCTATGAGTATTCGGAGCAGCCAAAGTGTGTCTGTACTGCGGATCCCAAGTCAAAGCCAACTGAGCCACGCCTACTCCCAGAGCTCTCTCCACCGCAGT

GTCAGCCAGCTCATGGACATGGCAGACAAGAAGGTTGTTACGGAAGACTCACTGTGGGAAACTATTATGGGCCACAGCAGTGGACTG TATGTGGACGAA

GAAGAGCTCATGAACGCCATCAAGGGTTTCAGCTCCGTGACCAAGGAGCACACCGCCTTTACCGACACCCACCTCTGAATAAACAATCAAGTTAGAGCGT

GGAACCCTGGGATGCATGCTCTGCACACTGTTTTTTTTTTTTTTCCAGTTGCCACCACATGTGATAAAAGCTGAAAAAAGCTGAAACAAAA
Translation
MHYLALSPGFLCYTIKTLILAYLASVLVLAASQGVFPRLENVGAFRKVSTVPTHATCGFPGPSTFCRSPVAAEHVQLCTERLCIQDCPYRSASPLYTALL

EGLRSCIPADDGDLHPYSRSSSVSFMFGSHQNCPSLRAPRLAAELTLAVWLKLEQGGTM MCVIEKTVDGQIVFKVTISEKETMFYYRTVNGLQPPIKVM

TPGRILMKKWIHLTVQ VHQTAISFFVDGLEENSTAFDTRTLHDSVTDSVSSVIQVGQSLNG - UNI31635 - GSEQFVGRMQDFRLYNVSLTNR R

EILEVFSGDFPHLHIQPHCRCPGSHPRVHPSVQQYCIPNGAGDTPEHRMSRLNPEAHPLSFINDDDVATSWISHVFTNITQLYEGVAISIDLENGQYQ V

LKVITQFSSLQPVAIRIQRKKADSSPWEDWQYFARNCSVWGMKDNEDLENPNSVNCLQLPD DFIPFSHGNVTFDLLTSGQKHRPGYNDFYNSSVLQEFM

RATQIRLHFHGQYYPAGHTVDWRHQYYAVDEIIVSGR RCQCHGHAETCDRTRRPYRCLCSPHSFTEGPQ CDRCSPLYNDKPFRSGDNVNAFNCKPCQC

HGHASSCHYDASVDPFPLEHNRGGGGVCDDCQHHTTG GRHCESCQDYFYRPVGADPAAPDACKLCDCNRAGTRNGSLHCDP IGGQCDCKRRVSGRQCL

QCQDGFYDLQALDPDGCRPCNCNPSGTVDGDITCHQNSGQCSCKANVIG GLRCNRCNFGFKFLQSFNGDGCEPCQCNLHGSVNQLCDPLSGQCACKKEA

KGLKCDSCRENFYGLPWSACEVCDCSKAGSQPGTVCDTETGQCVCKPNVGGRQCSQCKAGYFNLYQNDSHLCLTCNCEKMGTVNGSLRCDKSTGQCPCKL

GVTGLRCHQCKPHRFNLTMDNPQGCQACDCDSLGTLPGSMCDPISGQCLCLPHRQGRRCEQCQPG GFYSSPSNATGCLPCLCHTAGAVSHICNSVTGQC

SCHDPSTTGRSCHQCQESYFRFDPLTGR RCRPCHCHVAGASNGTCDAVTGQCFCKEFVTGSKCDTCVPGASHLDVNNLLGCSKT TPSQQPPPRGWVQS

SSTINVSWSPPECPNAHWLTYTLFRNGSEIYTTEDEHPYY YTQYFLDTSLSPHTAYSYYIETSNVHSSTRSIPVIYETKPEVSEGHLNLTHIIPVGSDS

ITLTWTGLSNSSDPVAKYVLSCTPVDSTEPCVSYEGPETSATIWNLVPFTQYCFSVQGCTNESCFYSLPIIVTTAQAPPQTQGPPTVWKISPTELRIEWS

PPVDSNG GIIISYELYMRRWLSTEESLVFESHGLVSSHSALQSVNPSKNLLQQPQASTFISGLEPHTEYAFRVLAVNMAGRVSSAWASERTGESV VPV

FMAPPSVSPLSPHSLSVSWEKPAENFTRGEIIGYKISMVSEHFPLHDVPVMCSK MVHFAKSQDQSYIVRGLEPYRTYSFTVSLCDSVGCVTSALGSGQT

LAAA APAQLRPPMVTGVNSTTVHIRWLPPAGVNGPPPLYHLERKKSSLPAATAAVTKGTRFVGHGYCRFPRTAHADFIG GIKASFRTRVPEGLILLAL

SPGDQEEYFTLQLKNGRPYFLYNSQ GTLVEVTPTDDPSQGYRDGEWHEIIAVRHQAFGQITLDGQYTG GSSSSLNGSSVTGGYTGLFVGGVPQGHSVL

QKRLE EIIQRGFVGCLKDVFIMKGYSPSGTWLPLDWQSSEEQVNVHPSWEGCPTNLEEGVQFLGAG GFLELPSDTFHAAKDFEISLKFQTDQLNGLLL

FIHNTEGPDFLA VELKRGLLSFKFNSSLVFTRVDLRLGLADCDGKWNTVSIKKEGSVVSVRVNALKKSTSQAGGQPLLVNSPVYLGGIPRELQDAYRHL

TLEPG GFRGCVKEVAFARGVVVNLASVSSRAVRVNQDGCLSSDSTVNCGGNDSILVYRGSQQSVYESGLQPFTE EYLYRVTASHEGGAVSSDWSRGRT

LGTA APQSVPTPSRAQSINGSSVEVAWNEPAVVKGVLEKYVLKAYSEDSSQPRVPSASTELHDTSTHSG GVLIGLHPFHSYTVTLTACSRAGCTESSQ

ALSISTPQEA APQEVQAPVAVALPNSLSFFWSLPRQANGIITQYSLYVDGRLVYTGKGQNYTVTD DLRVFAAYEIIVGACTQAGCTNSSQVILHTAQL

PPEQVDPPGLTVLDSRTIHVR RWKQPRQLNGILERYILYILNPIHNSTMWSVVYNSTEKLQAHVLHHLSPGGLYLIRLR - UNI35741 - VCTGGG

CTTSEPSQALMEETIPEGVPAPRAHSYSPDSFNISWTEPEYPNG GVITTYELYLDDTLIHNSSGLSCHAYGFDPGSLHTFQVQACTAKGCALGPL VGN

RTLEAPPEGVVNVLVKPEGSREAHVRWDAPAHPNGRLTYSVHFTGSFYADQA AGDNYTLLSGTKTIRGIEGSRLWVLVDGLVPCSHYMVQVNASNSRGS

VLSDPVSVEMPPGA APDGLLSPRLAAAAPTSLQVVWSTPARNNAPGSPRYQLQMRPGPSTHGRLE ELFPIPSASLSYEVTGLQPFTVYEFRLVATNGF

GTAYSAWTPLMTTEDK KPGPIDAPILINVKARMLSVIWRQPAKCNGAITHYNIYLHGRLYLTVSGRVTNYTVVPLHPYKAYHFQVEACTSQGCSKSPSS

ETVWTLPGNPEGIPSPQLFPYTPTSIIVTWQPSAHLDLLVENVTIERRVKGKKEVRNLVTLARSQAMKFIDNDPALRPWTRYEYRVLGSTLDGGTNSSAW

VEVTTRPCRPSGVQPPTVRVLAPDTVE VSWKAPLMQNGDILSYEIRMPEPLIKMTNMSSIMLSHLVKHLIPFTNYSVTIVACSGGNGYLAGCTESPPTL

ATTHPAPPQELAPLSVILLSESDVGISWQPPSKPNGPNLR RYELLRCKIQQPLASNPPEDLNLWHNIYSGTRWFYKDKGLSR RFTTYEYKLFVHNSVG

FTPSREVTVTTLAGSPERGATVTASILNHTAIDVRWKKPT TFQDLQGDVEYYTLFWSSGTSEESLKIFPDVDFHVIGQLSPNVEYQVFLLVFNGVHAIN

STVVHVTMWEEE EPQGMLPPEVVIINSTAVRVIWTSPSNPNAVVTESSVYVNNKLYKTGTDAPGSFVLEDLSPFTIYDIQ VEVCTKDACVKSNGTQVS

TAEDTPSDISIPVIRGITSR RSLQIDWTTPANPNGIILGYDVLRKTWRPCSETQKLTDKPRDELCKAVKCQYPGKVCGHTCYSPGTK VCCDGLLYDPQ

PGYSCCEDKYIALSPNATGVCCGGRMWEAQPDHQCCSGHYARILPG GEICCPDERHNRVSVGFGDACCGTMPYATSGSQVCCAGRLQDGYRQQCCGGEM

VSQDFQCCGGGEEGMVYSYLPG GMLCCGQDYVNMSETICCSASSGESKAHVRKDDPTPVKCCGTELSPESQRCCDGVGYNPLKYVCSDEISAGMAMK E

TRVCATICPATMKATAHCGRCDFNATTHICTVMRGPLNPTGKKAVEGLCSAAEEIVHSGDVNTHSFID DRDLKPSTVYEYRISAWNSYGRGFSQSVRAS

TREDVPEGVKAPRWARTGKHEDVIFLQWEEPMQSNG GPIIHYILFRDGRERFQGTALSFTDTQGIQPLQEYSYQLKACTAAGCAVSCK VVAATTQRSP

ENVPPPNITAQSSETLHLSWSVPEKMKDAIKAYQLWLDGKGLIYTDTSDRRQHTVTG GLQPYTNYSFTLAVCTSVGCTSSEPCVGQTLQAAPQG GVWV

TPRHIIINSTTVELYWNPPERPNGLISQYQLRRNGSLLLVGGRDNQSFTDSNLEPGSR RYIYKLEARTGGGSSWSEDYLVQMPLWTPEDIHPPCNVTVL

GSDSIFVAWPTPG GNLLPKIPVEYSILLSGGSVTLLVFSVRHRQSAHLKNLSPFTQYEIRIQACQNG GGCGVSPGTYVRTLEAAPVGLMPPLLKALGS

SCIEVKWMPPTRPNGIITSYVVHR RRPADTEEESLLFVWSEGALEFTDDTGTLRPFTLYEYRVRAWNSQGAVDSPWSTIQTLEAPPRGLPAPRVQATSA

HSAMLNWTEPEAPNGLISQYHVIYQERPDAAAPGSSTVHAFTVT GTSRQAHLFGLEPFTTYHIGVVAVNSAGKVSSPWTLIKTLESAPSGLMNFTVEQR

EKGRALLLQWSEPVKTNGVIK AYNIFNDGVLEYSGLGRQFLFRRLAPFTLYTLILEACTTAGCAHSVPQPLWTEEAPPDTQMAPTIQSVGPTNVRLHWS

QPASPNGKIIHYEVIRRRSEEEDWGNTTWQADGNTVFTEYNTQGNAWVYNDTGLQPWRQYAYRICAWNSAGHTCSSWNVVRTLQAPPDGLSPPEISYVSM

SPLQLLISWLPPRHSNGVIQGYRLQRDGVLPALNFNASTFSYMDSQLLPFSTYSYAILACTGGGCCTSEPTNITTPEVPPSEVSPPVLWDISAHQMNVSW

SPPSIPNGKIVKYLLQCDGEEHLAGQGLSFLLSNLQPSTQYNISLVACTSGGCTASRTTSAWTKEAPPENMDPPTLHITGPESIEITWTPPRNPHGLIRS

YELRRDGAIVYVGLETRYHDFTLAPGVEYSYSVTATNSRGSVLSPLVKGQTSPSAPSGLQPPKLHSGDALELLADWDPPVRTNGKIINYTLFVREMFEGK

TRAMSINTTHSSFGTRSLTVKHLKPFHR RYEVRVQACTALGCTSSEWTSTQTSEVPPLRQPAPHLEVQTATGGFQPIVAVWWAGPLQPNGKIICFELYR

RQVAAWPGTSSSLLIYNGSFRSFMDSELLPFTEYEYQ VWAVNSAGKAASNWTRCRTGPAPPEGLQAPTFHTVSSTRAVVNISVPSRPNGNISLFRVFSN

SSGTHVT LSEGTATQQTLHDLSPFTTYTIGVEACTCFNCCSRGPTAELRTHPAPPSGLSPPQVQTLGSRMASVHWTPPLLPNGVIHS SYELQLQRACP

PDSAPRCPPSHTERKYWGPGHRASLAGLQPNTAYGVQVVAYNEAGSTASGWTNFSTKKEM MPQYQALFSVDSNASMVWVDWSGTFLLNGHLKEYVVTDG

GRRVYSGLDTTLYIPRMVDKI IFFFQVTCTTDIGSVKTPLVQYDAATGSG GLVLTTPGEKKGAGTKSTEFYSELWFIMVMAVVGLILLAIFLSLILQR

KIHKEPCIRERPPLVPLQKRMTPLSVYPPGETHV GLADTRLPRSGTPMSIRSSQSVSVLRIPSQSQLSHAYSQSSLHRSVSQLMDMADKKVVTEDSLWE

TIMGHSSGL YVDEEELMNAIKGFSSVTKEHTAFTDTHL
Transcript ENSMUST00000061932
Sequence
GCCACCGAACAGCCTACACTGAGCTACAG GCACCGGCTTCGACTCATGTTTCTGTCCTCCCTCAGGACACCCTTGCTCTGCCTTCCCTGTGACAGTGTG

TCTACAGTCTCCCCAAGATGAAACATCTCAGGGATCAAGTGCCTTTCCAGGATTTCTGGTGAACAGTGCAGCCCTGGATCTTAATTTAGGAATGCTTCAT

TGGGTGAAGAATCCTTTTTTGTAATCATGCATTACCTGGCTCTCTCACCGGGCTTCCTGTGTTACACCATTAAAACATTGATCCTTGCCTATTTGGCTTC

GGTATTGGTGTTGGCTGCCTCACAGGGCGTTTTCCCAAGGCTGGAGAATGTGGGTGCTTTCAGGAAGGTATCCACTGTGCCAACCCACGCCACGTGTGGA

TTCCCAGGCCCTAGCACTTTTTGTCGTAGCCCGGTGGCGGCTGAGCATGTGCAACTGTGTACGGAGAGGCTGTGTATCCAGGATTGCCCCTACCGCTCTG

CCTCTCCTCTCTATACTGCCCTCCTAGAAGGCCTCCGGAGCTGCATCCCTGCAGACGACGGTGATCTCCACCCTTACTCCAGGAGCAGCTCCGTGAGCTT

CATGTTCGGAAGTCACCAGAACTGCCCGTCTCTACGGGCTCCGAGGCTGGCAGCCGAATTGACCTTAGCTGTGTGGTTGAAGCTTGAGCAAGGAGGCACT

AT GTGTGTGATAGAAAAGACAGTGGACGGGCAGATTGTGTTCAAAGTTACAATATCTGAGAAAGAGACCATGTTTTATTATCGCACAGTAAATGGTTTG

CAGCCTCCAATAAAAGTAATGACACCAGGGAGAATTCTTATGAAGAAATGGATTCATCTCACTGTGCAG GTGCATCAGACGGCAATCAGCTTCTTTGTG

GACGGTCTGGAGGAGAACAGTACTGCATTTGATACAAGAACTCTCCATGATTCAGTCACAGACTCAGTCTCCAGCGTGATACAAGTAGGACAGAGTTTAA

ATG - UNI31635 - GTTCAGAGCAGTTTGTTGGAAGAATGCAAGATTTTCGATTGTACAATGTGTCACTTACAAACAG GGAGATTCTAGAGGTCTT

TTCTGGAGATTTTCCTCACTTGCACATCCAGCCACATTGCCGATGTCCAGGTAGCCACCCCCGTGTCCACCCCTCCGTTCAGCAGTACTGCATTCCCAAT

GGTGCAGGAGACACGCCCGAGCATCGAATGTCACGGCTGAATCCCGAAGCCCACCCTCTCTCCTTCATCAATGATGACGACGTTGCTACTTCATGGATCT

CTCATGTGTTTACAAACATTACGCAGCTCTATGAAGGAGTGGCTATTTCTATAGACTTAGAAAATGGACAGTACCAGGTAACCAGGGACGGCCGGGCGGG

TGTACATGCTCTAGCTGCTGCAGTCAAATGA
Translation
 MHYLALSPGFLCYTIKTLILAYLASVLVLAASQGVFPRLENVGAFRKVSTVPTHATCGFPGPSTFCRSPVAAEHVQLCTERLCIQDCPYRSASPLYTAL

LEGLRSCIPADDGDLHPYSRSSSVSFMFGSHQNCPSLRAPRLAAELTLAVWLKLEQGGTM MCVIEKTVDGQIVFKVTISEKETMFYYRTVNGLQPPIKV

MTPGRILMKKWIHLTVQ VHQTAISFFVDGLEENSTAFDTRTLHDSVTDSVSSVIQVGQSLNG - UNI31635 - GSEQFVGRMQDFRLYNVSLTNR 

REILEVFSGDFPHLHIQPHCRCPGSHPRVHPSVQQYCIPNGAGDTPEHRMSRLNPEAHPLSFINDDDVATSWISHVFTNITQLYEGVAISIDLENGQYQV

TRDGRAGVHALAAAVK

For any suggestions or comments, please send an email to unitrap@crg.es