Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026617 (Bpnt1)
Chromosomal location
Chr 1: 187156028 - 187181656 (+)
Description
bisphosphate 3'-nucleotidase 1 Gene [Source:MGI (curated);Acc:Bpnt1-001]
RefSeq_dna
NM_011794 
RefSeq_peptide
NP_035924.2 
UniGene
Mm.227549 Mm.405394 
MGI
MGI:1338800 
Uniprot/SWISSPROT
Q9Z0S1 
Uniprot/SPTREMBL
Q3U449 Q3UBN8 
Human Ortholog
ENSG00000162813 (BPNT1)
Omim not available
UniTrap UNI29722
Vector Insertion
Chr 1: 187156143 - 187161984
Public Clones (sanger) E091H04 (ggtc) IST14012D8 (tigm) IST14729F7 (tigm) IST14126H11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17567
Vector Insertion
Chr 1: 187161991 - 187162112
Public Clones not available
Private Clones OST440660 (lexicon) OST425286 (lexicon) OST393404 (lexicon) OST366742 (lexicon)
OST363875 (lexicon) OST355701 (lexicon) OST347660 (lexicon) OST332722 (lexicon)
OST329145 (lexicon) OST319467 (lexicon) OST292017 (lexicon) OST291371 (lexicon)
OST286245 (lexicon) OST283634 (lexicon) OST276569 (lexicon) OST270028 (lexicon)
OST261534 (lexicon) OST260777 (lexicon) OST256871 (lexicon) OST232558 (lexicon)
OST232109 (lexicon) OST213759 (lexicon) OST196869 (lexicon) OST194977 (lexicon)
OST193588 (lexicon) OST184601 (lexicon) OST183596 (lexicon) OST180817 (lexicon)
OST177191 (lexicon) OST172070 (lexicon) OST167582 (lexicon) OST167480 (lexicon)
OST161497 (lexicon) OST149082 (lexicon) OST147353 (lexicon) OST137150 (lexicon)
OST131311 (lexicon) OST129126 (lexicon) OST125570 (lexicon) OST114600 (lexicon)
OST108761 (lexicon) OST105548 (lexicon) OST103644 (lexicon) OST67569 (lexicon)
OST56864 (lexicon) OST55134 (lexicon) OST54762 (lexicon) OST42683 (lexicon)
OST33410 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21630
Vector Insertion
Chr 1: 187162112 - 187165101
Public Clones CMHD-GT_271H8-3 (cmhd)
Private Clones OST323495 (lexicon) OST298583 (lexicon) OST239336 (lexicon) OST233116 (lexicon)
OST148986 (lexicon) OST68591 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16268
Vector Insertion
Chr 1: 187165207 - 187169193
Public Clones not available
Private Clones OST464353 (lexicon) OST321561 (lexicon) OST319711 (lexicon) OST224071 (lexicon)
OST219210 (lexicon) OST200686 (lexicon) OST184741 (lexicon) OST184531 (lexicon)
OST178086 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18459
Vector Insertion
Chr 1: 187169302 - 187170553
Public Clones not available
Private Clones OST423015 (lexicon) OST259874 (lexicon) OST196098 (lexicon)
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6727
Vector Insertion
Chr 1: 187177942 - 187180356
Public Clones RHA202 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000116478
Sequence
ATGGCTTCCAGCCACACCGTGTTGATGCGGCTGGTAGCTTCAGCATATTCTATCGCTCAAAAGGCAGGAACCATAGTCAGGTGTGTCATTGCTGAAGGAG

ACCTGGGCATCGTGCAGAAG - UNI17567 - - UNI21630 - ACCTCGGCCACCGACCTGCAGACCAAAGCCGACCGCTTGGTGCAGATGAGCAT

ATGCTCTTCCCTGGCCCGGAAGTTCCCGAAGCTGACCATCATAGGGGAAGAG - UNI16268 - GACCTGCCTCCTGGGGAAGTGGATCAAGAGCTGA

TTGAAGACGGGCAGTGGGAGGAGATCCTGAAGCAGCCGTGCCCCTCGCAGTACAGTGCTATCAAGGAGGAAGAC - UNI18459 - CTTGTGGTTTGG

GTTGACCCCTTAGATGGCACCAAGGAGTACACTGAAG GTCTTCTTGACAATGTAACAGTTCTCATTGGGATTGCTTATGAAGGAAAGGCCATCGCAGGC

ATCATCAACCAGCCGTATTACAACTACCAG GCAGGACCCGACGCGGCGCTGGGCAGGACCATCTGGGGAGTTCTGGGTTTGGGTGCTTTTGGGTTTCAG

CTGAAGGAAGCCCCTGCCGGGAAGCACATTATCACAACCACCAGATCCCATAGCAACCAGCTGGTCACAGACTGCATTTCCGCCATGAACCCCGACACCG

TGCTGCGAGTGGGAGGAGCAGGAAACAAG ATTATCCAGCTGATCGAAGGCAAAGCTTCTGCTTATGTGTTTGCAAGTCCTGGGTGTAAGAAGTGGGACA

CTTGTGCCCCGGAAGTTATCTTGCATGCTGTGGGAG - UNI6727 - GGAAGTTGACAGACATCCATGGGAATGCCCTGCAGTACAACAAGGAGGTGA

AACATATGAACTCTGCCGGTGTCCTGGCTGCACTGAGGAACTACGAGTACTATGCAAGCCATGTTCCAGAGTCGGTCAAAAATGCGCTCATTCCATGAAG

GGGTCTCACTTACCCAGAGGCCTTGGTTCAAAGGAACACATCTTAATACTGATTACTAATTGAACAATTGGAGCTCTGCCTGCATTTATCATTGATCAGC

GATTTATTAGTAGTTAGGGATAGAAGATGGAATTAAAGAATTTTCTTCACATC
Translation
MASSHTVLMRLVASAYSIAQKAGTIVRCVIAEGDLGIVQK - UNI17567 - - UNI21630 - TSATDLQTKADRLVQMSICSSLARKFPKLTIIG

EE - UNI16268 - DLPPGEVDQELIEDGQWEEILKQPCPSQYSAIKEED - UNI18459 - LVVWVDPLDGTKEYTEG GLLDNVTVLIGIAYEG

KAIAGIINQPYYNYQ AGPDAALGRTIWGVLGLGAFGFQLKEAPAGKHIITTTRSHSNQLVTDCISAMNPDTVLRVGGAGNK IIQLIEGKASAYVFASP

GCKKWDTCAPEVILHAVGG - UNI6727 - GKLTDIHGNALQYNKEVKHMNSAGVLAALRNYEYYASHVPESVKNALIP
Transcript ENSMUST00000027916
Sequence
GCGCACGCGCAGCCGCTGTCCTTCTCACAGCATTGGACCAGTGGACTTGGAGGCAGCCGGTTCCCGGACAGCGAGCCACCAGGCCGGACAGCGCTTAGGG

GACACCAGGCTGAGT - UNI29722 - GTTTATCATGGCTTCCAGCCACACCGTGTTGATGCGGCTGGTAGCTTCAGCATATTCTATCGCTCAAAAGG

CAGGAACCATAGTCAGGTGTGTCATTGCTGAAGGAGACCTGGGCATCGTGCAGAAG - UNI17567 - - UNI21630 - ACCTCGGCCACCGACCT

GCAGACCAAAGCCGACCGCTTGGTGCAGATGAGCATATGCTCTTCCCTGGCCCGGAAGTTCCCGAAGCTGACCATCATAGGGGAAGAG - UNI16268 

- GACCTGCCTCCTGGGGAAGTGGATCAAGAGCTGATTGAAGACGGGCAGTGGGAGGAGATCCTGAAGCAGCCGTGCCCCTCGCAGTACAGTGCTATCAA

GGAGGAAGAC - UNI18459 - CTTGTGGTTTGGGTTGACCCCTTAGATGGCACCAAGGAGTACACTGAAG GTCTTCTTGACAATGTAACAGTTCTC

ATTGGGATTGCTTATGAAGGAAAGGCCATCGCAGGCATCATCAACCAGCCGTATTACAACTACCAG GCAGGACCCGACGCGGCGCTGGGCAGGACCATC

TGGGGAGTTCTGGGTTTGGGTGCTTTTGGGTTTCAGCTGAAGGAAGCCCCTGCCGGGAAGCACATTATCACAACCACCAGATCCCATAGCAACCAGCTGG

TCACAGACTGCATTTCCGCCATGAACCCCGACACCGTGCTGCGAGTGGGAGGAGCAGGAAACAAG ATTATCCAGCTGATCGAAGGCAAAGCTTCTGCTT

ATGTGTTTGCAAGTCCTGGGTGTAAGAAGTGGGACACTTGTGCCCCGGAAGTTATCTTGCATGCTGTGGGAG - UNI6727 - GGAAGTTGACAGACA

TCCATGGGAATGCCCTGCAGTACAACAAGGAGGTGAAACATATGAACTCTGCCGGTGTCCTGGCTGCACTGAGGAACTACGAGTACTATGCAAGCCATGT

TCCAGAGTCGGTCAAAAATGCGCTCATTCCATGAAGGGGTCTCACTTACCCAGAGGCCTTGGTTCAAAGGAACACATCTTAATACTGATTACTAATTGAA

CAATTGGAGCTCTGCCTGCATTTATCATTGATCAGCGATTTATTAGTAGTTAGGGATAGAAGATGGAATTAAAGAATTTTCTTCACATCATCTAATACGC

TTAAGACTTAAGTATATGATACGATTGTCATTTCTCCTGCCTAAAAACAAATTAGCCAGGTGTGGTGGCACTTACAATAGTCATAGCTACTCCAGTGGTT

GAATCAGAGGATTGCTTGAGCCTAGCCTCCATTACATAGCAAGATATGCCTAAACACAGAGAAGGAAAACAAAAAAGGAATTTAATTTTACTAATTAGCT

AACAGGACCAGTTGTTTTTTTTTGTTTTTTTGTTTTTTTTTTTTTCCTTTCTCTTGTTGTTTGGGCTTTTTGTTTGTTTGCTTGTTTGTGGGTTTTGTTT

TGTTTGTTTATTTTTTTGTTTTTTGTTTTTGTTTTCAAGACAGGGTTTCTCTGTGTAGCCCTGGCTGTCCTGGAACTCACTTTGTAGACCAGGCTGGCCT

TGAACTCAGAAATCCGCCTGCCTCTGCCTCCCGAGTGCTGGGATTAAAGGCGTGTGCCACCACCGGCCGGCATTGTTTTTGTTTTTTTGAGACAGGGTTT

CTCTGTGCAGCCCCAGCTGTCCTGGAACTCACTCTGTAGACAAAGTTGGCCTTGCACTCAGAGATTCCCCTGCCTCTGCCTCCTTAGTGCAGGGATTAAG

GGCTTGCCCCACCACACCTGGCTCAAATGTTACTATTTCTAAGTGAAGAAATGAAAAAGGGTTAGTTTCAAATGACTGTCCAAGTCATTTGTGCAGTCAA

CATTCCTGCTGATAAACCAGATTTCTTCAGGGCACAGAGTCTTAAGTTACTCCAGAATTTCAGTTGTTTTGTTTTTTCACAGTAATTTTTAAAATTTCTG

ATTCCAAATAAGAATGCATATAATGATATTATTTATGTTGATTTATGGGGGAAAGTTTCTCTAAAATACATAGTCCTATCTTTTCATATTATATATCAGA

TTTTTTTCAAAAGTATTTGAAAATTATAAATAATGTGAGGATTAATTTATTCTCTTGTTATTAAAATCTATAATTGGAAAGCTGG
Translation
 - UNI29722 - MASSHTVLMRLVASAYSIAQKAGTIVRCVIAEGDLGIVQK - UNI17567 - - UNI21630 - TSATDLQTKADRLVQMSIC

SSLARKFPKLTIIGEE - UNI16268 - DLPPGEVDQELIEDGQWEEILKQPCPSQYSAIKEED - UNI18459 - LVVWVDPLDGTKEYTEG GL

LDNVTVLIGIAYEGKAIAGIINQPYYNYQ AGPDAALGRTIWGVLGLGAFGFQLKEAPAGKHIITTTRSHSNQLVTDCISAMNPDTVLRVGGAGNK IIQ

LIEGKASAYVFASPGCKKWDTCAPEVILHAVGG - UNI6727 - GKLTDIHGNALQYNKEVKHMNSAGVLAALRNYEYYASHVPESVKNALIP
Transcript ENSMUST00000110965
Sequence
ATTGGACCAGTGGACTTGGAGGCAGCCGGTTCCCGGACAGCGAGCCACCAGGCCGGACAGCGCTTAGGGGACACCAGGCTGAGT - UNI17567 - - 

UNI21630 - - UNI29722 - ACCTCGGCCACCGACCTGCAGACCAAAGCCGACCGCTTGGTGCAGATGAGCATATGCTCTTCCCTGGCCCGGAAGT

TCCCGAAGCTGACCATCATAGGGGAAGAG - UNI16268 - GACCTGCCTCCTGGGGAAGTGGATCAAGAGCTGATTGAAGACGGGCAGTGGGAGGAG

ATCCTGAAGCAGCCGTGCCCCTCGCAGTACAGTGCTATCAAGGAGGAAGAC - UNI18459 - CTTGTGGTTTGGGTTGACCCCTTAGATGGCACCAA

GGAGTACACTGAAG GTCTTCTTGACAATGTAACAGTTCTCATTGGGATTGCTTATGAAGGAAAGGCCATCGCAGGCATCATCAACCAGCCGTATTACAA

CTACCAG GCAGGACCCGACGCGGCGCTGGGCAGGACCATCTGGGGAGTTCTGGGTTTGGGTGCTTTTGGGTTTCAGCTGAAGGAAGCCCCTGCCGGGAA

GCACATTATCACAACCACCAGATCCCATAGCAACCAGCTGGTCACAGACTGCATTTCCGCCATGAACCCCGACACCGTGCTGCGAGTGGGAGGAGCAGGA

AACAAG ATTATCCAGCTGATCGAAGGCAAAGCTTCTGCTTATGTGTTTGCAAGTCCTGGGTGTAAGAAGTGGGACACTTGTGCCCCGGAAGTTATCTTG

CATGCTGTGGGAG - UNI6727 - GGAAGTTGACAGACATCCATGGGAATGCCCTGCAGTACAACAAGGAGGTGAAACATATGAACTCTGCCGGTGTC

CTGGCTGCACTGAGGAACTACGAGTACTATGCAAGCCATGTTCCAGAGTCGGTCAAAAATGCGCTCATTCCATGAAGGGGTCTCACTTACCCAGAGGCCT

TGGTTCAAAGGAACACATCTTAATACTGATTACTAATTGAACAATTGGAGCTCTGCCTGCATTTATCATTGATCAGCGATTTATTAGTAGTTAGGGATAG

AAGATGGAATTAAAGAATTTTCTTCACATC
Translation
 - UNI17567 - - UNI21630 - - UNI29722 - MSICSSLARKFPKLTIIGEE - UNI16268 - DLPPGEVDQELIEDGQWEEILKQPCP

SQYSAIKEED - UNI18459 - LVVWVDPLDGTKEYTEG GLLDNVTVLIGIAYEGKAIAGIINQPYYNYQ AGPDAALGRTIWGVLGLGAFGFQLKE

APAGKHIITTTRSHSNQLVTDCISAMNPDTVLRVGGAGNK IIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGG - UNI6727 - GKLTDIHGNA

LQYNKEVKHMNSAGVLAALRNYEYYASHVPESVKNALIP

For any suggestions or comments, please send an email to unitrap@crg.es