Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026618 (Iars2)
Chromosomal location
Chr 1: 187110533 - 187153275 (-)
Description
isoleucine-tRNA synthetase 2, mitochondrial Gene [Source:MGI (curated);Acc:Iars2-001]
RefSeq_dna
NM_198653 
RefSeq_peptide
NP_941055.1 
UniGene
Mm.331142 
MGI
MGI:1919586 
Uniprot/SWISSPROT
Q8BIJ6 
Uniprot/SPTREMBL
Q810V2 Q8C1P9 Q8R2M5 Q8BIL6 
Human Ortholog
ENSG00000067704 (IARS2)
Omim not available
UniTrap UNI678
Vector Insertion
Chr 1: 187113423 - 187114364
Public Clones DC0374 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027921
Sequence
GAGCTCTTCAAGGGTCTCTACCTTTAGGTACCGGGCGGCTGCCGTGGGCCGTGTGCGGAGGGCTCCGCCCGGCTCGTCCACCATGCACTGGGGGCTGTGC

CCTCGCGGGCCCGGGGCGGCGGCGGTCGCCGCGGCTGGGAGCTTCTGGGGGCCAGCCCGTTTGCCCAGCCGCCTAGGGTGTCTGGGGATGACGAGGAGGC

TCGTGGTACGATCCGTGGCCGGGGCGGACAGCCCCCAGAGCAGCTCGAAAGGCGGCAGATACCGTGACACGGTGCTGCTGCCGCAGACCAGCTTCCCGAT

GAAGCTGCTGGGCCGCCAGCAGTCCGACATGGAGCTGGAGATCCAGCAG AAATGTGGCTTTTCAGAGCTTTATTCCTGGCAAAGAGAAAGAAAAGTAAA

GACGGAATTTTGCCTTCATGACGGGCCTCCTTATGCCAACGGTGACCCTCATGTTGGGCATGCCCTGAACAAG ATTTTGAAAGACATTGCCAATCGATT

CCATATGATGAGAGGTTCCAAGGTACACTTTGTGCCTGGCTGGGATTGCCATGGCTTGCCCATTGAAACAAAAGTGTTATCAGAGCTCGGTGTAGATGCC

CAGAGTCTTTCAGCCATGGAGATCAGGGAGAAAG CCAGATCATTTGCTCAGGCAGCCATTGAAAAGCAGAAATCGGCGTTTGTCCGCTGGGGAGTGATG

GCAGACTGGAATAACTGCTATTACACATTTGACCCAAAGTACGAAGCCAAGCAGCTGAGAGTATTCTACCAAATGTATGAGAAG GGCTTGGTTTATCGA

TCTTACAAACCAGTATATTGGTCTCCCTCATCAAG GACTGCGTTGGCTGAAGCAGAGCTTGAATACAACCCTGAGCATGTCAGTCGGTCGATATACGTA

AGATTCCCCCTCCTGAGACCTCCTCCGAAGTTGGAGTCTCTTACAG ATGCCTCATCCCCTGTTAGCGTTTTAGTTTGGACCACCCAGCCTTGGACAATT

CCCGCCAACCAGGCAATTTGCTATATGCCAGAGGCAAA GTATGCTGTGGTGAAATGTTCTGCCTCTGGGCACCTCTACATCCTGGCTGAAGATAAAATA

GCACCTGTCGCTTCTGCCTTGGAAACAACATTTGATGTTGTTGCAGCATTTTCAG GTGTGGATCTGGAAGGTGGCACTTGTAGTCACCCTTTAACTCCC

GATAAAGTGTCTCCTCTTTTACCTGCTACCCACGTGACTATGGCCAAAGGAACAGGGTTGGTTCACACAGCCCCAGCTCACGGTATGGAAGATTACAGCG

TAGCATCTCAGCACAGCCTCCCTATG GACTGTTTAGTGGATGAAGGCGGAATGTTCACCGATGCCGCAGGCCCTGAACTTCAGAACAAGGCTGTACTTA

AAGAAGGAACAGATGTGG TTATAAAGATGCTTCAAGCTACCAAGAATGTGTTGAAAGAAGAGAACATTGTGCACAGCTATCCCTGTGACTGGAGAACTA

AGACACCCGTGCTGATTCGAGCCAGCAAGCAGTGGTTTGTAAATATCACGGACATCAAGGCTGCAGCTAAG GAGTCGTTGAAGACGGTGAAGTTCATTC

CCGGAGCCGCACTGAACAGCATGACGGACATGCTGGACAGACGGCCGTACTGGTGCATATCCCGGCAGAGAGTCTGGGGGGTTCCCATTCCTGTGTTTCA

TCATAAGACAAAAGATGAATATTTGATCAACAG CCAAACCACTGAGCATATTATTAAACTCGTCGAGCAGCACGGCAGTGATGTGTGGTGGACCCTCCC

TGCTGAGCAGCTTCTCCCGGCAGAAGTCCTAGCTCAG GCTGGTGGCCCTGGGGCTTTGGAATACGCGCCAGGGCAGGACATTTTGGACATCTGGTTTGA

CAGTGGAACTTCATGGTCTTGTGTTCTTCAAG ACACGCAGCAGAGGGCAGACTTGTACCTGGAGGGAAAGGACCAGCTCGGGGGCTGGTTCCAGTCTTC

CTTACTAACAAGTGTGGCCACCAGGTCAAAAGCACCTTTCAG GACAGTGATGGTTCATGGATTTACACTTGGAGAAAAAGGAGAAAAGATGTCCAAGTC

CCTCGGGAATGTCATTAATCCTGACACTATCATCAGTGGAGGAAAA GACCACAGCAAAGAACCTCCCTACGGAGCTGACATCCTGCGCTGGTGGATAGC

TGAGTCCAATGTCTTCACGGAGGTGACCATTGGCCCCTCTGTACTCTCTGCTGCCAGAGATGACATCAGCAAG CTCAGAAACACACTCCGCTTTCTCTT

GGGAAATTTGACCGGTTTTAACCCCGAGACAGATTCTGTTCCCGTGAAGAATATGTATGTCATAGACCAGTATATGCTGCACTTAATTCAGGATTTTGCG

ACAAAG ATTACTGACTCATACAAACAGTATGACTTTGGGAAAGTTGTCAGGCTGTTGAAAGCCTTCTACACCAGAGAACTGTCCAGCTTTTACTTCAGC

ATAGTCAAGGATAG GCTCTACTGCGAAAACGAGAAGGATCCCAAGCGCCGCTCGTGTCAGACAGCATTGGCAGAAATTTTGGATGTGTTGGTCCGTGCT

TTTGCCCCCATTCTTCCTCACTTGGCAGAAGAGGTGTTTCAGCACATTCCCTATGTTACAG - UNI678 - AACCCAAGAGTGTTTTTCGCACTGGCT

GGATTAATACAAGCTCTATTTGGAAGAAGCCAGGACTGGAGGAGGCAGTGGAAAGTGCGTGCGCCATGAGGGACTCCTTTCTTGGCAGCATCCCTGGCAA

AAATGCTGCTGAGTACGAGGTCATCATAGTGATCGAGCCAGGGCTGCTGTTTGAGATCATGGAG ATGCTCCAAGCTGAGGAGACCTCTAGCACGTCTCA

GCTGAATGAGCTGATGATGGCTTCCCAGACGACATTGCTGGCTCAGGAGCCACGGGAAAGAACTGCAGGTGACATTGAGCTCACGGGGACATTCGTCATC

AATCTAGAAG GTGGTGACATTCGTGAGGAGTCTTCATATAAAGTCATTGTGGTACCGACTGCCAGAGAGAAGTGCCCTCGATGTTGGAAGCATACCTCT

GAGACTGCAGACGCTCTCTGTCCTCGGTGTGCAGAGGTCATTGGTGCAAAGTAGCAACCTGATGTCAACAGACGACGACACTCCCCACAGTACTGACTGG

CTGAGGAGATGAGCTGTTAGACAGTTCCCTAGAAAGAAATCCAAGGCTTACACAGAAAGTAGAGGGGCAGATAGATGGTAGCAGATGGGGTAAGAATCAG

AAGATTAAAAGAATATTTCTTGTAACTATAGAAAGAATAATGTATGTATATATATATATATGGAGATATATATGCAGATATACATATATACAGGGCACAC

ACACACACACACTCATGACTTCTTCAGAGACAGACACTGAATATGGTTACTTTCAATGTGGCAGAATGTTTTATATTTTATTAAAACTTTTTTGACTCAG

TATTTAAGCTCTATGATATCTGAAAATAAAGGCATTCTGGGAAACTCCC
Translation
MHWGLCPRGPGAAAVAAAGSFWGPARLPSRLGCLGMTRRLVVRSVAGADSPQSSSKGGRYRDTVLLPQTSFPMKLLGRQQSDMELEIQQ KCGFSELYSW

QRERKVKTEFCLHDGPPYANGDPHVGHALNK ILKDIANRFHMMRGSKVHFVPGWDCHGLPIETKVLSELGVDAQSLSAMEIREKA ARSFAQAAIEKQK

SAFVRWGVMADWNNCYYTFDPKYEAKQLRVFYQMYEK GLVYRSYKPVYWSPSSR RTALAEAELEYNPEHVSRSIYVRFPLLRPPPKLESLTD DASSP

VSVLVWTTQPWTIPANQAICYMPEAK KYAVVKCSASGHLYILAEDKIAPVASALETTFDVVAAFSG GVDLEGGTCSHPLTPDKVSPLLPATHVTMAKG

TGLVHTAPAHGMEDYSVASQHSLPM DCLVDEGGMFTDAAGPELQNKAVLKEGTDVV VIKMLQATKNVLKEENIVHSYPCDWRTKTPVLIRASKQWFVN

ITDIKAAAK ESLKTVKFIPGAALNSMTDMLDRRPYWCISRQRVWGVPIPVFHHKTKDEYLINS SQTTEHIIKLVEQHGSDVWWTLPAEQLLPAEVLAQ

 AGGPGALEYAPGQDILDIWFDSGTSWSCVLQD DTQQRADLYLEGKDQLGGWFQSSLLTSVATRSKAPFR RTVMVHGFTLGEKGEKMSKSLGNVINPD

TIISGGK DHSKEPPYGADILRWWIAESNVFTEVTIGPSVLSAARDDISK LRNTLRFLLGNLTGFNPETDSVPVKNMYVIDQYMLHLIQDFATK ITDS

YKQYDFGKVVRLLKAFYTRELSSFYFSIVKDR RLYCENEKDPKRRSCQTALAEILDVLVRAFAPILPHLAEEVFQHIPYVTE - UNI678 - EPKSV

FRTGWINTSSIWKKPGLEEAVESACAMRDSFLGSIPGKNAAEYEVIIVIEPGLLFEIME MLQAEETSSTSQLNELMMASQTTLLAQEPRERTAGDIELT

GTFVINLEG GGDIREESSYKVIVVPTAREKCPRCWKHTSETADALCPRCAEVIGAK
Transcript ENSMUST00000110975
Sequence
GGAGCGCGTGCGCAGTTCCTCGCCGCCGAGCTCTTCAAGGGTCTCTACCTTTAGGTACCGGGCGGCTGCCGTGGGCCGTGTGCGGAGGGCTCCGCCCGGC

TCGTCCACCATGCACTGGGGGCTGTGCCCTCGCGGGCCCGGGGCGGCGGCGGTCGCCGCGGCTGGGAGCTTCTGGGGGCCAGCCCGTTTGCCCAGCCGCC

TAGGGTGTCTGGGGATGACGAGGAGGCTCGTGGTACGATCCGTGGCCGGGGCGGACAGCCCCCAGAGCAGCTCGAAAGGCGGCAGATACCGTGACACGGT

GCTGCTGCCGCAGACCAGCTTCCCGATGAAGCTGCTGGGCCGCCAGCAGTCCGACATGGAGCTGGAGATCCAGCAG AAATGTGGCTTTTCAGAGCTTTA

TTCCTGGCAAAGAGAAAGAAAAGTAAAGACGGAATTTTGCCTTCATGACGGGCCTCCTTATGCCAACGGTGACCCTCATGTTGGGCATGCCCTGAACAAG

 ATTTTGAAAGACATTGCCAATCGATTCCATATGATGAGAGGTTCCAAGGTACACTTTGTGCCTGGCTGGGATTGCCATGGCTTGCCCATTGAAACAAAA

GTGTTATCAGAGCTCGGTGTAGATGCCCAGAGTCTTTCAGCCATGGAGATCAGGGAGAAAG CCAGATCATTTGCTCAGGCAGCCATTGAAAAGCAGAAA

TCGGCGTTTGTCCGCTGGGGAGTGATGGCAGACTGGAATAACTGCTATTACACATTTGACCCAAAGTACGAAGCCAAGCAGCTGAGAGTATTCTACCAAA

TGTATGAGAAG GGCTTGGTTTATCGATCTTACAAACCAGTATATTGGTCTCCCTCATCAAG GACTGCGTTGGCTGAAGCAGAGCTTGAATACAACCCT

GAGCATGTCAGTCGGTCGATATACGTAAGATTCCCCCTCCTGAGACCTCCTCCGAAGTTGGAGTCTCTTACAG ATGCCTCATCCCCTGTTAGCGTTTTA

GTTTGGACCACCCAGCCTTGGACAATTCCCGCCAACCAGGCAATTTGCTATATGCCAGAGGCAAA GTATGCTGTGGTGAAATGTTCTGCCTCTGGGCAC

CTCTACATCCTGGCTGAAGATAAAATAGCACCTGTCGCTTCTGCCTTGGAAACAACATTTGATGTTGTTGCAGCATTTTCAG GTGTGGATCTGGAAGGT

GGCACTTGTAGTCACCCTTTAACTCCCGATAAAGTGTCTCCTCTTTTACCTGCTACCCACGTGACTATGGCCAAAGGAACAGGGTTGGTTCACACAGCCC

CAGCTCACGGTATGGAAGATTACAGCGTAGCATCTCAGCACAGCCTCCCTATG GACTGTTTAGTGGATGAAGGCGGAATGTTCACCGATGCCGCAGGCC

CTGAACTTCAGAACAAGGCTGTACTTAAAGAAGGAACAGATGTGG TTATAAAGATGCTTCAAGCTACCAAGAATGTGTTGAAAGAAGAGAACATTGTGC

ACAGCTATCCCTGTGACTGGAGAACTAAGACACCCGTGCTGATTCGAGCCAGCAAGCAGTGGTTTGTAAATATCACGGACATCAAGGCTGCAGCTAAG G

AGTCGTTGAAGACGGTGAAGTTCATTCCCGGAGCCGCACTGAACAGCATGACGGACATGCTGGACAGACGGCCGTACTGGTGCATATCCCGGCAGAGAGT

CTGGGGGGTTCCCATTCCTGTGTTTCATCATAAGACAAAAGATGAATATTTGATCAACAG CCAAACCACTGAGCATATTATTAAACTCGTCGAGCAGCA

CGGCAGTGATGTGTGGTGGACCCTCCCTGCTGAGCAGCTTCTCCCGGCAGAAGTCCTAGCTCAG GCTGGTGGCCCTGGGGCTTTGGAATACGCGCCAGG

GCAGGACATTTTGGACATCTGGTTTGACAGTGGAACTTCATGGTCTTGTGTTCTTCAAG ACACGCAGCAGAGGGCAGACTTGTACCTGGAGGGAAAGGA

CCAGCTCGGGGGCTGGTTCCAGTCTTCCTTACTAACAAGTGTGGCCACCAGGTCAAAAGCACCTTTCAG GACAGTGATGGTTCATGGATTTACACTTGG

AGAAAAAGGAGAAAAGATGTCCAAGTCCCTCGGGAATGTCATTAATCCTGACACTATCATCAGTGGAGGAAAA GACCACAGCAAAGAACCTCCCTACGG

AGCTGACATCCTGCGCTGGTGGATAGCTGAGTCCAATGTCTTCACGGAGGTGACCATTGGCCCCTCTGTACTCTCTGCTGCCAGAGATGACATCAGCAAG

GTCAGACCTGCTCAGGGAACTTTATGAGCATGCGTGAAAACGAGCTACATGTGGCTGTCTTTAAATGTCCATGTTAATTTGTTCAAAACAGTAACACTAA

GAAATGTACATGTCAGCCAGACAGTAGTGCACGCCTTTAATCTCAGCACTAGGGAGGTAGAAGTAGGCAGATCTCTGGGAGTTTGAGGCCAGCCTGGTCT

ACAAAGAGAGTACCAGGACAGCCATGGCACACAAAGAAACCCTGTCTTGAAAAACAAAATAAGCAAACAAAAAAAGTTCATATCTTTTTATATTTGATTA

GTGTATAGATTACACCATAAGCTGGTATAATATTGTGCTATACATATACTTTCCGTGTACTCAGTGACTTTGCAAGCTAGATTCGTTTCTTTTTTTTCAT

ATGTGAATCAGATGAAATAGCATATAGCCATCTCTGTATGAATAAACACATGAGCAAAACAGGCTAGGGAAGGGAGTTAGTGGTTGTTTCTTTATAAAAC

TGGGTATTAGAATGAGA
Translation
MHWGLCPRGPGAAAVAAAGSFWGPARLPSRLGCLGMTRRLVVRSVAGADSPQSSSKGGRYRDTVLLPQTSFPMKLLGRQQSDMELEIQQ KCGFSELYSW

QRERKVKTEFCLHDGPPYANGDPHVGHALNK ILKDIANRFHMMRGSKVHFVPGWDCHGLPIETKVLSELGVDAQSLSAMEIREKA ARSFAQAAIEKQK

SAFVRWGVMADWNNCYYTFDPKYEAKQLRVFYQMYEK GLVYRSYKPVYWSPSSR RTALAEAELEYNPEHVSRSIYVRFPLLRPPPKLESLTD DASSP

VSVLVWTTQPWTIPANQAICYMPEAK KYAVVKCSASGHLYILAEDKIAPVASALETTFDVVAAFSG GVDLEGGTCSHPLTPDKVSPLLPATHVTMAKG

TGLVHTAPAHGMEDYSVASQHSLPM DCLVDEGGMFTDAAGPELQNKAVLKEGTDVV VIKMLQATKNVLKEENIVHSYPCDWRTKTPVLIRASKQWFVN

ITDIKAAAK ESLKTVKFIPGAALNSMTDMLDRRPYWCISRQRVWGVPIPVFHHKTKDEYLINS SQTTEHIIKLVEQHGSDVWWTLPAEQLLPAEVLAQ

 AGGPGALEYAPGQDILDIWFDSGTSWSCVLQD DTQQRADLYLEGKDQLGGWFQSSLLTSVATRSKAPFR RTVMVHGFTLGEKGEKMSKSLGNVINPD

TIISGGK DHSKEPPYGADILRWWIAESNVFTEVTIGPSVLSAARDDISKVRPAQGTL
Transcript ENSMUST00000110974
Sequence
GAGCTCTTCAAGGGTCTCTACCTTTAGGTACCGGGCGGCTGCCGTGGGCCGTGTGCGGAGGGCTCCGCCCGGCTCGTCCACCATGCACTGGGGGCTGTGC

CCTCGCGGGCCCGGGGCGGCGGCGGTCGCCGCGGCTGGGAGCTTCTGGGGGCCAGCCCGTTTGCCCAGCCGCCTAGGGTGTCTGGGGATGACGAGGAGGC

TCGTGGTACGATCCGTGGCCGGGGCGGACAGCCCCCAGAGCAGCTCGAAAGGCGGCAGATACCGTGACACGGTGCTGCTGCCGCAGACCAGCTTCCCGAT

GAAGCTGCTGGGCCGCCAGCAGTCCGACATGGAGCTGGAGATCCAGCAG AAATGTGGCTTTTCAGAGCTTTATTCCTGGCAAAGAGAAAGAAAAGTAAA

GACGGAATTTTGCCTTCATGACGGGCCTCCTTATGCCAACGGTGACCCTCATGTTGGGCATGCCCTGAACAAG ATTTTGAAAGACATTGCCAATCGATT

CCATATGATGAGAGGTTCCAAGGTACACTTTGTGCCTGGCTGGGATTGCCATGGCTTGCCCATTGAAACAAAAGTGTTATCAGAGCTCGGTGTAGATGCC

CAGAGTCTTTCAGCCATGGAGATCAGGGAGAAAG CCAGATCATTTGCTCAGGCAGCCATTGAAAAGCAGAAATCGGCGTTTGTCCGCTGGGGAGTGATG

GCAGACTGGAATAACTGCTATTACACATTTGACCCAAAGTACGAAGCCAAGCAGCTGAGAGTATTCTACCAAATGTATGAGAAG GGCTTGGTTTATCGA

TCTTACAAACCAGTATATTGGTCTCCCTCATCAAG GACTGCGTTGGCTGAAGCAGAGCTTGAATACAACCCTGAGCATGTCAGTCGGTCGATATACGTA

AGATTCCCCCTCCTGAGACCTCCTCCGAAGTTGGAGTCTCTTACAG ATGCCTCATCCCCTGTTAGCGTTTTAGTTTGGACCACCCAGCCTTGGACAATT

CCCGCCAACCAGGCAATTTGCTATATGCCAGAGGCAAA GTATGCTGTGGTGAAATGTTCTGCCTCTGGGCACCTCTACATCCTGGCTGAAGATAAAATA

GCACCTGTCGCTTCTGCCTTGGAAACAACATTTGATGTTGTTGCAGCATTTTCAG GTGTGGATCTGGAAGGTGGCACTTGTAGTCACCCTTTAACTCCC

GATAAAGTGTCTCCTCTTTTACCTGCTACCCACGTGACTATGGCCAAAGGAACAGGGTTGGTTCACACAGCCCCAGCTCACGGTATGGAAGATTACAGCG

TAGCATCTCAGCACAGCCTCCCTATG GACTGTTTAGTGGATGAAGGCGGAATGTTCACCGATGCCGCAGGCCCTGAACTTCAGAACAAGGCTGTACTTA

AAGAAGGAACAGATGTGG TTATAAAGATGCTTCAAGCTACCAAGAATGTGTTGAAAGAAGAGAACATTGTGCACAGCTATCCCTGTGACTGGAGAACTA

AGACACCCGTGCTGATTCGAGCCAGCAAGCAGTGGTTTGTAAATATCACGGACATCAAGGCTGCAGCTAAG GAGTCGTTGAAGACGGTGAAGTTCATTC

CCGGAGCCGCACTGAACAGCATGACGGACATGCTGGACAGACGGCCGTACTGGTGCATATCCCGGCAGAGAGTCTGGGGGGTTCCCATTCCTGTGTTTCA

TCATAAGACAAAAGATGAATATTTGATCAACAG ACGTATGTTGTCACCAGCACTGTTGACTTACGCGCTAAGGTAG
Translation
MHWGLCPRGPGAAAVAAAGSFWGPARLPSRLGCLGMTRRLVVRSVAGADSPQSSSKGGRYRDTVLLPQTSFPMKLLGRQQSDMELEIQQ KCGFSELYSW

QRERKVKTEFCLHDGPPYANGDPHVGHALNK ILKDIANRFHMMRGSKVHFVPGWDCHGLPIETKVLSELGVDAQSLSAMEIREKA ARSFAQAAIEKQK

SAFVRWGVMADWNNCYYTFDPKYEAKQLRVFYQMYEK GLVYRSYKPVYWSPSSR RTALAEAELEYNPEHVSRSIYVRFPLLRPPPKLESLTD DASSP

VSVLVWTTQPWTIPANQAICYMPEAK KYAVVKCSASGHLYILAEDKIAPVASALETTFDVVAAFSG GVDLEGGTCSHPLTPDKVSPLLPATHVTMAKG

TGLVHTAPAHGMEDYSVASQHSLPM DCLVDEGGMFTDAAGPELQNKAVLKEGTDVV VIKMLQATKNVLKEENIVHSYPCDWRTKTPVLIRASKQWFVN

ITDIKAAAK ESLKTVKFIPGAALNSMTDMLDRRPYWCISRQRVWGVPIPVFHHKTKDEYLINR RRMLSPALLTYALR

For any suggestions or comments, please send an email to unitrap@crg.es