Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000026663 (Atf6)
Chromosomal location
Chr 1: 172634588 - 172797902 (-)
Description
activating transcription factor 6 Gene [Source:MGI Symbol;Acc:MGI:1926157]
RefSeq_peptide
NP_001074773.1 
UniGene
Mm.377046 Mm.399439 
MGI
MGI:1926157 
Uniprot/SPTREMBL
B2RU98 Q811K9 Q8BZ84 
Human Ortholog
ENSG00000118217 (ATF6)
Omim not available
UniTrap UNI6756
Vector Insertion
Chr 1: 172785321 - 172797780
Public Clones (sanger) HMA263 (baygenomics) IST14847E6 (tigm) IST10727G10 (tigm)
IST11633F10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2424
Vector Insertion
Chr 1: 172783124 - 172785243
Public Clones AV0714 (sanger) AC0304 (sanger)
Private Clones OST262132 (lexicon) OST198281 (lexicon) OST175319 (lexicon) OST115715 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25752
Vector Insertion
Chr 1: 172779349 - 172783035
Public Clones not available
Private Clones OST167664 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI653
Vector Insertion
Chr 1: 172765172 - 172770811
Public Clones DC0415 (sanger) DC0597 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11996
Vector Insertion
Chr 1: 172729877 - 172745553
Public Clones G058E06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9031
Vector Insertion
Chr 1: 172640219 - 172677236
Public Clones GST171 (baygenomics) GST008 (baygenomics) GST048 (baygenomics) RST561 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027974
Sequence
GTTACTCACCCATCCGAGTTGTGAGGGAGAGGTGTCTGTTTCGGGGAAGCCGGCTTGTGTTGCCGGCGCCATGGAGTCGCCTTTTAGTCCGGTTCTTCCT

CATGGACCAGATGAAGACTGGG - UNI6756 - AGTCGACGTTGTTTGCTGAACTTGGCTATTTCACAGACACTGATGATGTGCACTTTGATGCAGCA

CATGAGGCTTAT - UNI2424 - GAAAATAATTTTGATCATCTTAATTTTGATTTGGATTTGATGCCTTGGGAGTCAGACCTATGGAGCCCCGGCAGC

CACTTCTGCTCAG - UNI25752 - ACATGAAGGCAGAGCCCCAGCCTCTTTCTCCGGCTTCCTCCAGTTGCTCCATCTCCTCTCCTCGGTCCACAGA

CTCGTGTTCTTCAACTCAGCACGTTCCT GAGGAGTTGGATTTGTTGTCTAGTTCTCAGTCCCCCCTTTCCTTATATGGCGACAGCTGTAATAGCCCCTC

CTCTGTAGAGCCACTGAAGGAAGAGAAGCCTGTCACTGGTCCTGGAAACAAAACAG AACATGGACTGACTCCAAAGAAAAAAATTCAGATGAGTTCAAA

ACCTTCAGTTCAGCCCAAGCCTTTATTACTTCCAGCAGCGCCCAAGACTCAAACCAATGCCAGTGTCCCAGCAAAAGCCATCATCATTCAGACACTACCA

GCCCTTATGCCACTGGCAAAGCAGCAGTCGATTATCAGCATACAGCCTGCGCCCACCAAAG - UNI653 - GCCAGACTGTTTTGCTCTCTCAGCCGA

CTGTGGTTCAACTTCAGAGCCCTGCGGTTCTGTCGTCTGCTCAGCCGGTTCTTGCAGTCACTGGGGGAGCCGCACAGCTACCTAACCATGTGGTGAATGT

GCTGCCAGCCCCTGTGGTGAGCAGCCCGGTGAATGGAAAACTTTCCGTGACTAAACCTGTTCTACAAAGTGCCACCAGAAGTATGGGTTCGGAT ATCGC

TGTGCTGAGGAGACAGCAGCGGATGATAAAGAACCGAGAGTCTGCTTGTCAGTCGCGCAAGAAGAAGAAAGAGTATATGCTAGGACTGGAGGCCAGGCTC

AAGGCTGCCCTCTCAGAGAATGAGCAGCTGAAGAAGGAGAATGGCTCCCTGAAGCGACAGCTGGACGAGGTGGTGTCAGAG AACCAGAGGCTCAAAGTC

CCAAGTCCAAAGCGAAGAGCTGTCTGTGTGATGATAGTATTAGCATTTATAATGCTGAACTATGGGCCCATGAG - UNI11996 - CATGCTGGAGCA

AGAATCCCGAAGAGTGAAACCTAGTGTGAGCCCTGCCAATCAGAGGAGGCATCTCTTGGAATTTTCAGCAAAAGAAGTTAAAGACACATCAGATGGTGAC

AACCAGAAAGACAGTTACAG CTATGATCACTCTGTGTCCAATGACAAAGCTTTAATGGTGCTAAGTGAAGAGCCATTGCTTTATATGCCTCCACCTCCA

TGTCAACCCCTGATTAACACAACAGAGTCTCTCAG GTTGAACCATGAACTTCGAGGCTGGGTTCATAGACATGAAGTGGAAAGGACCAAATCTAGAAGA

ATGACAAATAGCCAACAGAAAGCCCGCATTCTCCAG GGTGCTCTGGAACAGGGCTCTAATTCTCAGCTGATGGCTGTCCAGTACACAGAAACCACTAGC

ATCAG TAGGAATTCTGGGAGTGAGCTGCAAGTGTATTACGCCTCCCCTGGAAGTTACCAAGGCTTCTTTGACGCCATCCGCAGGAGGGGAGATACGTTT

TACGTTGTCTCATTTCGAAGG GATCATCTGCTATTACCAGCTACCACCCACAACAAGACCACAAGACCAAAAATGTCAATTGTATTACCAGCAATAAAC

ATAAATG - UNI9031 - ATAATGTGATCAATGGGCAGGACTATGAAGTAATGATGCAGATTGACTGTCAGGTGATGGACACCAGGATCCTCCACATC

AAAAGCTCCTCGGTTCCCCCTTATCTCCGGGATCATCAGCGGAACCAAACCAGCACCTTCTTTGGTTCCCCTCCAACAACCACAGAGACGACCCATGTGG

TCAGCACCATCCCTGAGTCGTTGCAGTAGTGCCCGAGCTGCGCTGGACAGCAGAGACTGAAGAGCTGGTGAAGATGCTGCTCTCTGCCTCTTCGGCAAGC

AGAGACTTGCCTTGTACGCAACTCCAGGGGAAGAGGAAGAGAGAACAGGAAGTGCGCTGCTTGTCACCGTCCACCCAGTGGGGTGGAACATGCTAGCGAG

CAATTCTCTGGTGGCAGTGCAGCCCTGTGGGCAGTGTCGCCTGGTGTTGGTTCTGCTGTGTCATCTTTAGTGCTTTTCTCAATGTGTGTTTGGTTCTCAG

TTATCTTCCTTCAGGTCAGACCCACTTCCTCTTCTGTCCACTGCACTTCCTGGTGCAGTAAAGAGATTTGTATTTAAAGCTTTAGAACACATGCTCATGT

GGTTTCCACCAATTGGCTTTCTCTCTCCTTTGGTTCAAATCCATTCTGAATGTTATACTTGAGAAAACACATTTCAAAAAACCGAGCAGCCAAAAACATC

CCACAAAGAGTCAAAACAGTTTAGAGTTTGGGTAAAGGGATTATCTCCAGTTGGTAAGAGTTTATTTTTACTTGTGATTTGTGGTTCAGCCCTGGACAAA

TAACTGTTGTGGGGGTCACAGAGTGAGCCACACACTGGAGACAAGGGAAGGGAAGGCCAGTGGTGGAATGTAAGGGGAAGTGACTCCATTTTCATATGTA

TTTAAACACAGAGTTCCTGTGGCCTCGGTAAGCTCAGAGCTATAGCCACCCTCAGTGTTGGAACTCGGCTAATCAGCAGAGATCTTCAAAGATCTCAGGG

CACATGCTTGCCTCTCATTGTGGACCCTCAGCCCAGAGCATACTCCTGTGAAACCAGACTCAGCAAAGGGACTTGGAGGTCACTAGGCTTAAGCAAGACT

AGAGAGTTTCCCTTAAGGACCAACAGTGCACAGAGCAAGCATGGCTTCCCAGAGAAGCTGCAGCACAGTATGGTGAAGTTCTCAGTTTTTCCAGTGGAAA

GATGATAAAGGAATTAAGCTCTCTTTGTTGTTGCTATGGCTGTGAACATGGCTTTAATCCTAGCACCATTTGGAAGGAAAGGCAGGCTTTGTTTGATATC

AGCCTGGCCTACATTTCAAATTCCAGGACAGGACAGCTAAAGCTATATAAAGAACCCACCTCAAAAAATAGATGAATGAATAAATGAGTAAATAAACAAA

TACAAACAAAAAGCAAAGTTATGTTCACATATATTTTATTGTATTTTGCCTGCTTCCTTCACCATAGCAAGCAGCCACATTTCTATTGCACTGTACATTG

TACGTTACAAGTTCACAGAAATGGATGCCAGGACTCATGTCAGTCATGTGCTGCCTCCCTTCCCAGGATTTCAGCAGGTTCTCATAGACTCTTCCCAGCT

GGCTTGCCATTGTCAGGTGGTCCCATTCCAGTAAGCACAATGGCGGCTAAGTCCTCTTCTCTCTACAAGGAGTGACACACAGTCAGGTCATCTTTTGCCT

GTGGCCCCATTATGCCTGGCACTGTTCACCAACAACTGTTCCCTGGACAGCACTGCTGCCATCTAAGCTAAGGTGAGATGTTTTCAGGGCAGGGCCATTC

TTGCTGAATTCAGTGCCGCAGTCCATCCTGATTGGCTCTCGGGTGATTTTCAGACAAGACCTGTTTGTCCCGGGGGCTGGTCCTCTAATGGGTGCCAAGG

AGAAGATACCAAATACATGGAGTACCTTTAGGAGTAGCCATTTGTGGGGGAGGTGGGCTACCCTGTGGCCATGTCCTTCCTGCCTGTGAAGCAGCTCAAC

ACGAGGATGTGACTGTGGCTGTGGACAGAGGCAGCACACGCATTCCTGATGCTGATCTGCTGAGACACGAATAGAATCTGCAGTGACTCCAGTGTACCAG

TGCCTCAGATCAAAGACCTCAATAGTGTCACGTTTGCTAAGGCTGATGCCTCTCCTACAGGTAACAGTGGGGATGACCGTTGGAAGGCACAGCCAAAGAG

CAGACAGAAGTTAAGGTGGCCACAGCACAGGTCAGGGATCCAAGGAGCTGGGGAGGACTGCTCAAAACTAGTCTGGAAGCTTGCCTTCTCTGCTCCTGCT

GACCATCAGGTCCTGTCATTACCACTCTCAGGTCCGTCTTATGAGATGAGGAATGGGGCCCTCCTCAGGGGAGAGTTTCAGAAATGAGGGAAAGGCAATT

ATAGATAGAAAGAAGTATCCTGCCATTTAAATTGCTGAAAGAGCTAGAATCCCTGGGCTCGGTAGTTTGTATCTTAATGTTTGTGCGCTAGCACAGGCCC

ATTGGAGAGGAAAAGCTGTTGTCCTGGGAGCAAAGTAAGCAGCCATTCAGGTCTCATTTTTTATTTTGGTATGCTTGCCCTTGGGTGTTTATAGTCCGGA

ACTGTAGGAGCTATGTATGTACATAATATATATATTTTTTAATTTATTAAGTTTTAAAATGTGATTTTTCAAGATTATGAAAAAATTAAATAAATTTGAG

CTAGAGAAATGGCTCAGTGGTTAACTTCGCTTACTGCTCTTCCAGAGGACCCAGGTTCAGTTCCCAGCTTTAAGCCATCTCTAACTCCATTGGGGACAGG

CTAGGGGATGGGATCCTCTACCTTTTTCAGGCCTCTGCAGACACCAGACACACATAATGGTGCACATACATGTGTTCAGGCAAAACGCTAATATACATAA

AAAATAAAAACAAATAAATCTGGTTTTTCAATCAGATAAATTCCCAGAGGAAGTCACTCCACCTGTTACTAGATAATTTTGTGCCCTGGGCTGATGGTAC

TGTGATGTTGGGAAGTGTTGCTAGAGGCTGGCAGTGTGGTCTTTCCTGTGTTTGCAAGCCCCCCACTTTTAAATTCAGTGGGAGTAACTGCATGTTCCCT

CCTGTTAACAGAACAGCTTCTCTCTGCAGTTAGCTCATAAAACAGCTTCCTTAGAATAGAATGGAAACCCACTTTCAAGTTAGGAGGTGATGAGAACGGA

TGCTTGAGAGATGAATGTCAGCAGCACAAAGCTGTCCCCTTTGCCTTTCTTTCTCATTAGCAAGAAGTAGACCCTGGGCTGGCCAGATGGCTCAACTGCT

GAGAGCTCTTGCTGCATCTCCAGGAGACCCAAGTTCCATTCCTAACACCCATGACACAGCCCATAACCCCTAACTCCAGTTCCAGGAGATCTAATGCCCT

CTTCTAGTCTCCCTTGGCATCTGTGCACACATGGCATTCACTAACACAGTTACACATAAATAATAATATTAATCGTGAAGCAGACAAGGAAGTACTCAAA

AAGTTACATAATGTGCGTCATTCCTGAATTTTCCCAATAACTGTCACTTGAAAACAGAGGGAACTGACTTTCTCTCGTATGTTTAAAGTGACTGTCGTGG

TTCAATCTTGTTGGCCCAAATCTCCATCCTAGGCAAATATTCCCCAGTCGTTACAGCTGCCCAATGCTGTTAGTCATGGCTGCCATAACTAGAACATTTA

ACTCAAGACAACTCCCACAGTTCCACTGTGAGACTGTAAGACTGGGAATTTATCTAATTAAAAAGTCAGTCTTGCTGTTTTACTATGAAACTTGACAGAA

ATGTACCACAGCAACAAAACTAGGAATCACGGTTGACTTCCTCCCACATCAAAAACTTCCAGTCCGACTTCTGCTTTAATAGCATGTTAGAAGCTCTTGC

ATTTCCTTAACCTAGAGAGCCAGCGTTCCTATGCAGTGGCTCCCCATTCTGGTCTCATGGAGGTGCCCCCATCACCACAACACCCCTCCCCCGTGATAGC

CTTCTTTCCACCTCAGCCTGGGAGCATTGACCTCATCCTTCAGCAGGTACATACACCTCAACTTCCACATGTGACCTGTAGCTCTGTCATAAGAATCAAC

TTCCCAAGCTCTCCGCATAGTCCCAGACTTGAGAGTAGCTTATTGCCACCGGCAAACTCGTAGTCCTTACCCACCTGTTCTTTGGTCAGTTATGGGGCAT

TTTAATTTACATAAGTAATGATTTTTTTTTTTTGCTGCTAATATGAACACCAGTTATATTTTTAACCAAAAGAAAAAAAGTAAGGCCTAGAAGGAAGATA

ATGGATTGAGGACATTGTCATTCCCACCCTGATAGCACTTGGAAAGAGACATTTCCTCCCTGGTGCCCACTACAGGAATTGTGGGTGATTTTTAAGTAAC

TACTGGACTGCCTAGGAAGATATTCCCAGAGTCCGAAAGGAACTATGCACATAGAGAAAATACAGTTTTCTCCTACCTAAGGAAACTATTAGTATTCTAT

TAGCTTATATTTTTAATAACTAAGCTTAAAACATAGTTTATTTTGGATATTACTAGAACTTGCAGCAATTCTAATATCTGTCAGGTACTCATAGAATCTA

TGGGGAAAAAAAAGATAAGACTGTGTGATTAGGAAACTTTGTGAGTCATGGCATGGCCAGCCAGTGTCACAAAGCAACCCTGTGCTTGGCTAGCTTTAAG

CATTACAGACTTAGTACATGAAAAGACTTAATTATATTGGGTTCAGGAACTAAAGAGTCAATGAGTCATCTGTGGAGGTCAACAAATAACACACTGGTGG

GCTTTTTGTCCTCCGTCAAGCTGGTGACTATAGTGAAATGAAGCAGGAAGTGTAGCATATTCCCCAGGATGCTAGTTCCAGACTGAACCAGCAGACTGAA

TTCACAGCACGTGTGTGTCAATTGAACTAGCCTAGTTCATTATCACCTCTACTTTCTGGGCAGTTGCCAGGATGCAGGAGATGAAGAAAGCTACAAAGCA

CTGCTCTCTTTGAGATTCTAGGTTTTCTTTTCTTCTCATCATGGTAATGAGGGGCAGTGAAGCCAGAGGTTTAAATGAGCATAGACCCATGGTGGATGGG

GTATGTAGCTTAGATGGAAGACTGCTTGCTTAGAGTGCCCGAAGCCATGGCTTCCTTCACCACATAAACTAGGACGGTGGAGTGTGCTTAGAATCCTAGC

ATTTGGGAGGTGGAAGTGGGAAGATCGGGAGTTAAGGGTCAACCAGGGATACGTGGGACCCTGTCTTACCATGTGTGGAAGAAATGCAGGAAAAATGTAT

TGTTCTCTCCCTGAATAATTATGTCCGTTTACAATAAATAATGGTGGCAGACTATTTCATATTTTCAAACAAGTCTTTATAATGCAATACCTGTTCTTCC

TCTGAAATCCAAATAAAGACTTTTAAAACTTTGTTGTCTGTCTGTACAAAGACAAAAACAAATGAATCTTCAATGTTAAGTGGTTAGTAATGGGAATGGA

AGCCTAAAGAGGACCTGTGGCTTGTGGGTGTTTAGATAAAACACCGAGCTTGTTTCTCTGTCCTCCCACGATGGACCAAGTAGAAATTTGCTTTATGGAA

TCCAGACATGTGTACTACAGTCACATCAAGGAATAAAATCCTCTAAAACCC
Translation
LTHPSCEGEVSVSGKPACVAGAMESPFSPVLPHGPDEDWE - UNI6756 - ESTLFAELGYFTDTDDVHFDAAHEAY - UNI2424 - ENNFDHLN

FDLDLMPWESDLWSPGSHFCSD - UNI25752 - DMKAEPQPLSPASSSCSISSPRSTDSCSSTQHVP EELDLLSSSQSPLSLYGDSCNSPSSVEPL

KEEKPVTGPGNKTE EHGLTPKKKIQMSSKPSVQPKPLLLPAAPKTQTNASVPAKAIIIQTLPALMPLAKQQSIISIQPAPTKG - UNI653 - GQTV

LLSQPTVVQLQSPAVLSSAQPVLAVTGGAAQLPNHVVNVLPAPVVSSPVNGKLSVTKPVLQSATRSMGSD IAVLRRQQRMIKNRESACQSRKKKKEYML

GLEARLKAALSENEQLKKENGSLKRQLDEVVSE NQRLKVPSPKRRAVCVMIVLAFIMLNYGPMS - UNI11996 - SMLEQESRRVKPSVSPANQRR

HLLEFSAKEVKDTSDGDNQKDSYS SYDHSVSNDKALMVLSEEPLLYMPPPPCQPLINTTESLR RLNHELRGWVHRHEVERTKSRRMTNSQQKARILQ 

GALEQGSNSQLMAVQYTETTSIS SRNSGSELQVYYASPGSYQGFFDAIRRRGDTFYVVSFRR DHLLLPATTHNKTTRPKMSIVLPAININD - UNI9

031 - DNVINGQDYEVMMQIDCQVMDTRILHIKSSSVPPYLRDHQRNQTSTFFGSPPTTTETTHVVSTIPESLQ

For any suggestions or comments, please send an email to unitrap@crg.es